BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11l18f (607 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_05_0608 - 23628100-23631486 29 2.9 10_08_0361 + 17207657-17207701,17208850-17209773 27 8.7 >01_05_0608 - 23628100-23631486 Length = 1128 Score = 29.1 bits (62), Expect = 2.9 Identities = 16/31 (51%), Positives = 21/31 (67%) Frame = -3 Query: 515 SHILLISVELLSITSSILNMSSNFLSGTLIS 423 S++L V L I+ + LN+SSNFLSG L S Sbjct: 703 SNLLTGQVPQLPISMTRLNLSSNFLSGPLPS 733 >10_08_0361 + 17207657-17207701,17208850-17209773 Length = 322 Score = 27.5 bits (58), Expect = 8.7 Identities = 12/60 (20%), Positives = 26/60 (43%) Frame = +2 Query: 314 ESNNVTRLRKMKQKRNLHLLILGNSHQSLIQNKHSEKKLMCQTRNWRTYLK*NLLLTRVQ 493 E N + ++ + H+L+ N + N EK + +T+ W T L++ ++ Sbjct: 137 EDNQLLSQCDLRNDQTFHVLVCPNDKLHVFINVRGEKTIGLETKRWYTVADVKLMIENLE 196 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,140,400 Number of Sequences: 37544 Number of extensions: 259162 Number of successful extensions: 708 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 676 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 708 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1442939384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -