BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11l17r (723 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 25 2.4 AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. 25 3.1 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 24 4.1 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 25.0 bits (52), Expect = 2.4 Identities = 23/81 (28%), Positives = 36/81 (44%), Gaps = 3/81 (3%) Frame = -3 Query: 691 FLRSGNYNVIVVDWSS-FSLSTYSTAVMAVTG--VGSSIATFLKNLKLPLNKVHIVGFNL 521 +L +GN V ++D F++ + V A G +G+S A N K IVG + Sbjct: 2669 YLYAGNSPVSLIDPDGQFAILLIVSIVTAAVGAYLGASAANKSWNPAKWEVKKAIVGATM 2728 Query: 520 GAHVAGVTGRNLEGKVARITG 458 GA V G + G + + G Sbjct: 2729 GAIVGGFAPVGIAGSITFLAG 2749 >AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. Length = 786 Score = 24.6 bits (51), Expect = 3.1 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -2 Query: 431 KQRTTTGNKRCSIR*SYSHRRIWCQQKRLGHCY 333 K R+ T RC +R + H+R W + CY Sbjct: 446 KNRSLTEMGRCMLRDAGMHKRFWAEAVNTA-CY 477 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/37 (27%), Positives = 19/37 (51%) Frame = -3 Query: 574 LKNLKLPLNKVHIVGFNLGAHVAGVTGRNLEGKVARI 464 L+ +KL + K H ++ + + R EGK+ R+ Sbjct: 972 LEEMKLAIEKAHEGSSSIKKEIVALQKREAEGKMKRL 1008 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 757,214 Number of Sequences: 2352 Number of extensions: 15414 Number of successful extensions: 34 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73597131 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -