BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11l17f (623 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 25 2.0 AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein pr... 25 2.6 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 24 3.4 AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 24 4.5 AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 24 4.5 Y17689-1|CAA76814.1| 111|Anopheles gambiae gSG2 protein protein. 23 7.9 AJ130950-1|CAA10259.1| 114|Anopheles gambiae SG2 protein protein. 23 7.9 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 25.0 bits (52), Expect = 2.0 Identities = 23/81 (28%), Positives = 36/81 (44%), Gaps = 3/81 (3%) Frame = +2 Query: 293 FLRSGNYNVIVVDWSS-FSLSTYSTAVMAVTG--VGSSIATFLKNLKLPLNKVHIVGFNL 463 +L +GN V ++D F++ + V A G +G+S A N K IVG + Sbjct: 2669 YLYAGNSPVSLIDPDGQFAILLIVSIVTAAVGAYLGASAANKSWNPAKWEVKKAIVGATM 2728 Query: 464 GAHVAGVTGRNLEGKVARITG 526 GA V G + G + + G Sbjct: 2729 GAIVGGFAPVGIAGSITFLAG 2749 >AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein protein. Length = 476 Score = 24.6 bits (51), Expect = 2.6 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 107 GSLNKYYYYSNAQRNPITLTEDHF 178 GS + YYY N R ITL + ++ Sbjct: 323 GSGHLYYYEENGDRRKITLNDVYY 346 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 24.2 bits (50), Expect = 3.4 Identities = 10/37 (27%), Positives = 19/37 (51%) Frame = +2 Query: 410 LKNLKLPLNKVHIVGFNLGAHVAGVTGRNLEGKVARI 520 L+ +KL + K H ++ + + R EGK+ R+ Sbjct: 972 LEEMKLAIEKAHEGSSSIKKEIVALQKREAEGKMKRL 1008 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 23.8 bits (49), Expect = 4.5 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +2 Query: 164 TEDHFPTGNDPAAPFNNNWDIVVIIHGHSGTA 259 TE P G+ PF DIV+++ +GTA Sbjct: 5 TETEVPAGSVSDEPFLGPLDIVLLVSLLAGTA 36 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 23.8 bits (49), Expect = 4.5 Identities = 8/33 (24%), Positives = 18/33 (54%) Frame = -1 Query: 146 SVHCYSNNIYLNFQIAPSFEWHLRCKRQMQRPT 48 S++ YSN++Y+ F + + R+ + P+ Sbjct: 196 SIYSYSNHVYIRFAVGELLQRPAADSRRQEGPS 228 >Y17689-1|CAA76814.1| 111|Anopheles gambiae gSG2 protein protein. Length = 111 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/18 (50%), Positives = 15/18 (83%) Frame = -3 Query: 303 LLKNASLTIGLIVVVAVP 250 L+ A+L++ L+VVVA+P Sbjct: 5 LVAFATLSVALVVVVAIP 22 >AJ130950-1|CAA10259.1| 114|Anopheles gambiae SG2 protein protein. Length = 114 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/18 (50%), Positives = 15/18 (83%) Frame = -3 Query: 303 LLKNASLTIGLIVVVAVP 250 L+ A+L++ L+VVVA+P Sbjct: 5 LVAFATLSVALVVVVAIP 22 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 679,452 Number of Sequences: 2352 Number of extensions: 14203 Number of successful extensions: 29 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 60632475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -