BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11l16f (613 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC15A10.04c |zpr1||zinc finger protein Zpr1|Schizosaccharomyce... 26 3.7 SPAP27G11.08c |meu32|mug11|sequence orphan|Schizosaccharomyces p... 26 3.7 SPCC1223.02 |nmt1|thi3|no message in thiamine Nmt1|Schizosacchar... 26 4.9 SPAC12G12.03 |cip2||RNA-binding protein Cip2|Schizosaccharomyces... 25 8.6 SPBC31F10.12 |||RNA-binding protein Tma20 |Schizosaccharomyces p... 25 8.6 >SPAC15A10.04c |zpr1||zinc finger protein Zpr1|Schizosaccharomyces pombe|chr 1|||Manual Length = 459 Score = 26.2 bits (55), Expect = 3.7 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = -1 Query: 508 SSNQMEASGLAKPPSSCSF*GKSQWNKVIIGVMPYF 401 ++ E +G+ + S C GK+ K+++ V+PYF Sbjct: 22 TAEDREGNGVQEVESLCMECGKNGTTKLLLTVIPYF 57 >SPAP27G11.08c |meu32|mug11|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 392 Score = 26.2 bits (55), Expect = 3.7 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = +1 Query: 514 RAWSTRISVT--ESKHWITINEPREICYEGYGS 606 RAW +I ESK TI+EP +I G+GS Sbjct: 100 RAWKLQIHSKNLESKIEATISEPEQIPCPGFGS 132 >SPCC1223.02 |nmt1|thi3|no message in thiamine Nmt1|Schizosaccharomyces pombe|chr 3|||Manual Length = 346 Score = 25.8 bits (54), Expect = 4.9 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +1 Query: 463 NWEASPIHWLPFGLKTTRAWSTR 531 NWEA+P H LP L TR + R Sbjct: 11 NWEATPYH-LPIFLAQTRGYYER 32 >SPAC12G12.03 |cip2||RNA-binding protein Cip2|Schizosaccharomyces pombe|chr 1|||Manual Length = 576 Score = 25.0 bits (52), Expect = 8.6 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -2 Query: 561 DPMFXLCHRNSCRPRARSLQTKWK 490 DP + S +PR LQT WK Sbjct: 126 DPEISTANNPSAKPRRTRLQTAWK 149 >SPBC31F10.12 |||RNA-binding protein Tma20 |Schizosaccharomyces pombe|chr 2|||Manual Length = 184 Score = 25.0 bits (52), Expect = 8.6 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = -3 Query: 566 MVIQCXDSVTEIRVDHARVVFKPNGS 489 +V +C D+ T++RVD + F +G+ Sbjct: 87 LVHKCPDAFTQVRVDRGAIKFLLSGA 112 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,347,274 Number of Sequences: 5004 Number of extensions: 43098 Number of successful extensions: 127 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 123 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 127 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 267622334 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -