BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11l15r (719 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 25 0.62 AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 25 0.82 AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 24 1.4 EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 21 7.6 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 25.0 bits (52), Expect = 0.62 Identities = 9/31 (29%), Positives = 19/31 (61%) Frame = +2 Query: 608 CYFLNFCIHYINSSHY*IVNAYLFLIANYFF 700 C F+ F +H++ ++Y A++ L+ Y+F Sbjct: 87 CPFIIFTVHFLLCTYY-FYYAFIILLCVYYF 116 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 24.6 bits (51), Expect = 0.82 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +3 Query: 57 LKLYIHNIIVSTLRTIKT*CDTCFLTNYHIINT 155 L +YI I++ T TI+T + +HI+ T Sbjct: 227 LLIYIQVIVIGTKNTIETVAYSVIFILWHIVGT 259 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 23.8 bits (49), Expect = 1.4 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -1 Query: 563 EIFIHIKLLFFKAHCLNCF 507 EI I I L+FFK L CF Sbjct: 60 EIHIKIVLMFFKEASLYCF 78 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 21.4 bits (43), Expect = 7.6 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +1 Query: 208 LLNQSLINITNCDDN 252 L+ QS+ NIT+ DD+ Sbjct: 143 LMGQSIFNITSPDDH 157 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,870 Number of Sequences: 336 Number of extensions: 2727 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19155320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -