BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11l15f (602 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1781 + 29468919-29468951,29469057-29469184,29469349-294694... 37 0.011 05_06_0277 + 26885621-26886064,26886148-26886317,26887038-268879... 31 0.53 07_03_0971 + 23038409-23039134,23040321-23040611 30 1.2 03_02_0393 - 8075982-8076989 30 1.2 06_01_0320 - 2320317-2320336,2320791-2320902,2321092-2321236,232... 30 1.6 05_06_0276 + 26878732-26879574,26879920-26880387,26880800-268810... 29 2.1 03_04_0142 - 17656751-17657554 29 2.1 01_06_0405 + 29103723-29103839,29103928-29104012,29104572-291046... 29 2.1 08_01_0051 - 355392-355450,355507-355634,356271-356425,356883-35... 29 2.8 12_02_1177 - 26708215-26708309,26708355-26708392,26708476-267095... 29 3.7 10_06_0029 + 9822216-9823124,9825210-9825329,9826188-9826304,982... 29 3.7 10_02_0201 - 6764313-6765263 28 5.0 09_04_0161 - 15232074-15232139,15232299-15232406,15233417-152335... 28 5.0 02_02_0017 - 6131265-6131284,6131654-6131774,6132011-6132146,613... 28 5.0 07_01_0671 + 5036069-5037670 28 6.5 05_05_0132 - 22611030-22611908,22612016-22612135,22612644-226128... 28 6.5 01_01_0542 + 3975500-3975546,3976273-3976370,3976694-3976830,397... 28 6.5 10_02_0100 + 5296783-5297568 27 8.7 05_06_0102 - 25589011-25589181,25589269-25589496,25589589-255899... 27 8.7 04_03_0401 - 15438674-15438772,15439084-15439348,15439822-154399... 27 8.7 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 27 8.7 >07_03_1781 + 29468919-29468951,29469057-29469184,29469349-29469433, 29469771-29469824,29470072-29470163,29470280-29470383, 29470811-29470886,29471231-29471678,29471874-29471916, 29471977-29472209,29472302-29472505,29472595-29472693, 29472789-29472861,29473373-29473500,29473614-29473836, 29473992-29474215,29474296-29474423,29475053-29475167, 29475603-29475658,29475795-29475888,29475966-29476152, 29476229-29476309,29476384-29476484,29476567-29476629, 29476800-29476907 Length = 1059 Score = 37.1 bits (82), Expect = 0.011 Identities = 21/83 (25%), Positives = 40/83 (48%), Gaps = 1/83 (1%) Frame = +3 Query: 270 VQHGFPHRASALAWDPXXXXXXXXXXXXXXKVYGRPGVELYGQHTNYESIVTQ-IHFITG 446 + +G P+ AS LA+DP K++G +E G + S+ + + FI Sbjct: 29 LHYGIPYTASLLAFDPVQRLLALATLDGRIKIFGGDNIE--GLLISPNSLPYKFLQFIQN 86 Query: 447 TGRLISLCDDNSLHLWEINEKSL 515 G LI++ ++N + +W + + L Sbjct: 87 QGFLIAISNENEIQVWNLEFRQL 109 >05_06_0277 + 26885621-26886064,26886148-26886317,26887038-26887941, 26888544-26888575,26888862-26888928,26889116-26889173, 26889329-26889421,26890366-26890480,26890847-26890894, 26891012-26891057,26891161-26891231,26891865-26891870, 26891991-26892038,26892439-26892488,26892892-26893154 Length = 804 Score = 31.5 bits (68), Expect = 0.53 Identities = 19/58 (32%), Positives = 26/58 (44%) Frame = +1 Query: 256 HSERQSSMASRTERQHSRGIRSSDSRRLVPPPERSRSTADQASNSTANTPITNR*SHR 429 HS R SR+ + R S RR PP R RS A ++ + +P+ SHR Sbjct: 217 HSRRSGRSRSRSPARD----RGSPPRRRSPPARRERSPAPRSRSPRRRSPVKTTSSHR 270 >07_03_0971 + 23038409-23039134,23040321-23040611 Length = 338 Score = 30.3 bits (65), Expect = 1.2 Identities = 11/52 (21%), Positives = 30/52 (57%), Gaps = 1/52 (1%) Frame = +3 Query: 381 VELYGQHTNYESIVTQIHFITGTGRLISLCDDNSLHLWEINEKSLVE-LKSH 533 +++Y H N + + +T ++S +DN +++W++ K++++ L+ H Sbjct: 253 LKMYSGHVNRKYCLQSAFSVTNGKYIVSGSEDNCVYIWDLQGKNILQKLEGH 304 >03_02_0393 - 8075982-8076989 Length = 335 Score = 30.3 bits (65), Expect = 1.2 Identities = 17/42 (40%), Positives = 21/42 (50%), Gaps = 8/42 (19%) Frame = -1 Query: 443 CDEMYLCDYRFVIGVLAVEFDAW--------SAVDLERSGGG 342 CD Y DY +GVL F A+ + +DL RSGGG Sbjct: 59 CDSSYPGDYHAAVGVLVAAFAAYCFLSTLAFTVLDLARSGGG 100 >06_01_0320 - 2320317-2320336,2320791-2320902,2321092-2321236, 2321353-2321459,2321572-2321665,2321752-2321948, 2322311-2322382,2322504-2322618,2323060-2323176, 2323253-2323344,2323445-2323621,2323746-2323820, 2323911-2324051,2324671-2324859,2325298-2325363, 2325445-2325595,2325718-2325786,2326293-2326441, 2326526-2326657,2326756-2327081,2327167-2327203, 2327926-2327980,2328242-2328309,2328464-2328466 Length = 902 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 2/53 (3%) Frame = +3 Query: 420 VTQIHFITGTGR--LISLCDDNSLHLWEINEKSLVELKSHVFEGKNKKISAIC 572 V + + TG R LI+ DD++ +W+ KS V+ EG ISA+C Sbjct: 183 VNCVDYFTGGDRPYLITGSDDSTAKVWDYQTKSCVQ----TLEGHTHNISAVC 231 >05_06_0276 + 26878732-26879574,26879920-26880387,26880800-26881021, 26881153-26881278,26881309-26881573,26881719-26881936 Length = 713 Score = 29.5 bits (63), Expect = 2.1 Identities = 22/57 (38%), Positives = 29/57 (50%), Gaps = 6/57 (10%) Frame = +1 Query: 277 MASRTER-QHSRGIRSSDSR-----RLVPPPERSRSTADQASNSTANTPITNR*SHR 429 MAS ER +HSR S SR R PP R RS A ++ + +P+ + SHR Sbjct: 1 MASAVERREHSRRSGRSRSRSPARDRGSPPRRRERSPAARSRSPRRRSPVKSTSSHR 57 >03_04_0142 - 17656751-17657554 Length = 267 Score = 29.5 bits (63), Expect = 2.1 Identities = 16/54 (29%), Positives = 29/54 (53%) Frame = +1 Query: 253 LHSERQSSMASRTERQHSRGIRSSDSRRLVPPPERSRSTADQASNSTANTPITN 414 +HSE+Q++ S + R S+ RR +PPP ++S + +++ PI N Sbjct: 139 IHSEQQTTWLSSSSRASGNEGYSNPIRRPLPPPVETQSPS--VNHANHGVPILN 190 >01_06_0405 + 29103723-29103839,29103928-29104012,29104572-29104674, 29104798-29104882,29105414-29105497,29105627-29105730, 29106522-29106783,29106978-29107414,29107637-29107718, 29109913-29110089,29110640-29110732,29110812-29110877, 29110992-29111038,29111165-29111430,29111443-29111845, 29111992-29112376 Length = 931 Score = 29.5 bits (63), Expect = 2.1 Identities = 16/37 (43%), Positives = 18/37 (48%) Frame = +3 Query: 474 DNSLHLWEINEKSLVELKSHVFEGKNKKISAICVESS 584 DNS H W NEK L E+ H +G K S E S Sbjct: 513 DNSAHCWMFNEKHLEEIPLHT-DGPELKESVDLTEVS 548 >08_01_0051 - 355392-355450,355507-355634,356271-356425,356883-357012, 357600-357739,358384-358552,360286-360557 Length = 350 Score = 29.1 bits (62), Expect = 2.8 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 3/46 (6%) Frame = +1 Query: 283 SRTERQHSRGIRSSDSRRLVPPPERSRSTA---DQASNSTANTPIT 411 S T+ Q +RG+ + +++L P P+R+ S A D ++ NTP T Sbjct: 67 SGTKYQAARGVEEATAKQLRPRPDRTPSIAIPVDSDASPRKNTPET 112 >12_02_1177 - 26708215-26708309,26708355-26708392,26708476-26709563, 26709826-26709945,26710018-26710098,26710696-26710812, 26711122-26711904 Length = 773 Score = 28.7 bits (61), Expect = 3.7 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +3 Query: 195 IRGKGQQPSAERQKLQNELFAFRKTVQHGFPH 290 I G+G A+R N FA + + HGFPH Sbjct: 225 ISGEGSAAGADRGGRINRPFAGMRFILHGFPH 256 >10_06_0029 + 9822216-9823124,9825210-9825329,9826188-9826304, 9826387-9826476,9826706-9826756 Length = 428 Score = 28.7 bits (61), Expect = 3.7 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +1 Query: 304 SRGIRSSDSRRLVPPPERSRSTADQASNSTANTPITNR*SHRYISSQGQAV*Y 462 SR SS S +P +R A ++TA P+T R +S QG++ Y Sbjct: 47 SRHASSSSSSSSLPSCSAARVAVTPAPHATATAPVTMRMRSLSVSFQGESFVY 99 >10_02_0201 - 6764313-6765263 Length = 316 Score = 28.3 bits (60), Expect = 5.0 Identities = 16/53 (30%), Positives = 24/53 (45%), Gaps = 8/53 (15%) Frame = -1 Query: 443 CDEMYLCDYRFVIGVLAVEFDAW--------SAVDLERSGGGTKRRESEERIP 309 CD Y DY +G L F A+ + +D+ R+GGG R + +P Sbjct: 44 CDSAYPGDYSPAVGALVAAFAAYCLVSAAAFAVLDIGRAGGGGGRNRRKYMVP 96 >09_04_0161 - 15232074-15232139,15232299-15232406,15233417-15233506, 15233617-15233733,15234408-15234527,15234930-15236168 Length = 579 Score = 28.3 bits (60), Expect = 5.0 Identities = 18/67 (26%), Positives = 32/67 (47%) Frame = +1 Query: 211 SSPLLRGRSCRMNYLHSERQSSMASRTERQHSRGIRSSDSRRLVPPPERSRSTADQASNS 390 +SP+ RGR Y + S A+ R S + + P P+R++S AD+ S Sbjct: 30 ASPVNRGRDVASRYKNGLSAHSAATTARRCTSPSPGRTSANECTPEPKRAQS-ADRRRPS 88 Query: 391 TANTPIT 411 T ++ ++ Sbjct: 89 TPSSRVS 95 >02_02_0017 - 6131265-6131284,6131654-6131774,6132011-6132146, 6132423-6132529,6133006-6133099,6133199-6133395, 6134401-6134472,6135128-6135304,6135393-6135467, 6135557-6135697,6136439-6136627,6136969-6137034, 6137118-6137268,6137596-6137664,6138751-6138899, 6138969-6139100,6139198-6139523,6139599-6139635, 6139765-6139803,6140196-6140250,6140363-6140424, 6140512-6140532,6140820-6140822 Length = 812 Score = 28.3 bits (60), Expect = 5.0 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 2/53 (3%) Frame = +3 Query: 420 VTQIHFITGTGR--LISLCDDNSLHLWEINEKSLVELKSHVFEGKNKKISAIC 572 V + + TG R LI+ DD + +W+ KS V+ EG +SA+C Sbjct: 201 VNCVDYFTGGDRPYLITGSDDQTAKVWDYQTKSCVQ----TLEGHAHNVSAVC 249 >07_01_0671 + 5036069-5037670 Length = 533 Score = 27.9 bits (59), Expect = 6.5 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -1 Query: 377 WSAVDLERSGGGTKRR 330 WS+VD E+ GGG +RR Sbjct: 165 WSSVDEEQQGGGARRR 180 >05_05_0132 - 22611030-22611908,22612016-22612135,22612644-22612856, 22612968-22613288,22613421-22613504 Length = 538 Score = 27.9 bits (59), Expect = 6.5 Identities = 17/69 (24%), Positives = 26/69 (37%) Frame = +1 Query: 199 AARASSPLLRGRSCRMNYLHSERQSSMASRTERQHSRGIRSSDSRRLVPPPERSRSTADQ 378 +A SSP + S R H A+ +RQ GI+ + S + +TA Sbjct: 44 SASTSSPPVTSPSARQQPHHHHPPPPQAAPPDRQRDDGIKEAKSSDAAAAAAQKTATATA 103 Query: 379 ASNSTANTP 405 + T P Sbjct: 104 VTRPTTTAP 112 >01_01_0542 + 3975500-3975546,3976273-3976370,3976694-3976830, 3977518-3977871,3977953-3978041,3978502-3978589, 3978659-3978734,3978858-3978907,3979032-3979340, 3979803-3979982,3980086-3980325,3980471-3980582, 3980931-3981040,3981162-3981311,3981777-3981932, 3982289-3982405,3982759-3982839,3983338-3983478 Length = 844 Score = 27.9 bits (59), Expect = 6.5 Identities = 13/42 (30%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +3 Query: 402 TNYESIVTQIHFITGTGRLISLCD-DNSLHLWEINEKSLVEL 524 T + + V + F LI CD DN + W IN ++V + Sbjct: 689 TGHSASVMSLDFHPNKDDLICSCDGDNEIRFWSINNGNIVRI 730 >10_02_0100 + 5296783-5297568 Length = 261 Score = 27.5 bits (58), Expect = 8.7 Identities = 17/60 (28%), Positives = 26/60 (43%) Frame = +1 Query: 232 RSCRMNYLHSERQSSMASRTERQHSRGIRSSDSRRLVPPPERSRSTADQASNSTANTPIT 411 R C L ++SSMA ER + + D R P + S T + + +TP+T Sbjct: 40 RLCDEQELRRAKKSSMAEEVERIKGKLVGGEDGGR--PSSDSSEETVVELLRALRSTPMT 97 >05_06_0102 - 25589011-25589181,25589269-25589496,25589589-25589933, 25590406-25590777,25590957-25591049,25591150-25591401, 25592019-25593224 Length = 888 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +3 Query: 390 YGQHTNYESIVTQIHFITGTGRLISLCDDNSLHLWEI 500 + +HTN VT +HF+ L+S D ++ W++ Sbjct: 415 FSEHTN---AVTAVHFMANNHSLLSASLDGTIRAWDL 448 >04_03_0401 - 15438674-15438772,15439084-15439348,15439822-15439915, 15439997-15440099,15440342-15440384,15440420-15440484 Length = 222 Score = 27.5 bits (58), Expect = 8.7 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 4/43 (9%) Frame = +1 Query: 247 NYLHSERQSSMASRTE----RQHSRGIRSSDSRRLVPPPERSR 363 N H++R+ S T +H +GI++S +RRL+ RSR Sbjct: 106 NSQHNKRRKSTKHATPWASIERHGKGIKASAARRLILQASRSR 148 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 27.5 bits (58), Expect = 8.7 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 Query: 343 PPPERSRSTADQASNSTANTPITNR 417 PPP RSR T + ST +TP T + Sbjct: 310 PPPARSRRTPPRTRFSTGSTPDTKQ 334 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,561,595 Number of Sequences: 37544 Number of extensions: 295795 Number of successful extensions: 1066 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 1033 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1066 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1431112012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -