BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11l14r (748 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1442.01 |ste6|SPCC1450.17|guanyl-nucleotide exchange factor ... 27 3.8 SPAC25G10.08 |||translation initiation factor eIF3b |Schizosacch... 26 6.6 >SPCC1442.01 |ste6|SPCC1450.17|guanyl-nucleotide exchange factor Ste6|Schizosaccharomyces pombe|chr 3|||Manual Length = 911 Score = 26.6 bits (56), Expect = 3.8 Identities = 19/87 (21%), Positives = 44/87 (50%), Gaps = 3/87 (3%) Frame = -2 Query: 438 NTVYSTDNNVSYFNK--MPSNQ*LKTSTVINEVVDKLEYARAFIQRFPATFSVISFINVD 265 +T Y +++ V++ + + + + + V+ + +Y R + F + FS+IS +N Sbjct: 705 STFYLSNHLVNFVTETIVQEEEPRRRTNVLAYFIQVCDYLRE-LNNFASLFSIISALNSS 763 Query: 264 KFHRLK*S-CFVNSRISIN*DTIKKLT 187 HRL+ + +NS+ + + + LT Sbjct: 764 PIHRLRKTWANLNSKTLASFELLNNLT 790 >SPAC25G10.08 |||translation initiation factor eIF3b |Schizosaccharomyces pombe|chr 1|||Manual Length = 725 Score = 25.8 bits (54), Expect = 6.6 Identities = 13/54 (24%), Positives = 24/54 (44%) Frame = -2 Query: 441 LNTVYSTDNNVSYFNKMPSNQ*LKTSTVINEVVDKLEYARAFIQRFPATFSVIS 280 L Y D +SY+ S + S V ++VD+ + ++Q P ++S Sbjct: 157 LTDYYGRDQFISYYGNRVSVNWNRKSDVPEQIVDRENWTETYVQWSPMGTYLVS 210 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,801,469 Number of Sequences: 5004 Number of extensions: 54292 Number of successful extensions: 110 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 106 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 110 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 355273338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -