BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11l14r (748 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1520 + 27415266-27415507,27415608-27415722,27415761-274158... 29 3.0 07_01_0442 - 3348638-3349126,3349978-3350322 29 3.9 >07_03_1520 + 27415266-27415507,27415608-27415722,27415761-27415815, 27415862-27417849,27418161-27418589 Length = 942 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -2 Query: 432 VYSTDNNVSYFNKMPSNQ*LKTSTVINEVVDKLEYARAFI 313 +Y +NN SY N Q ++ TV+ E K+E R F+ Sbjct: 875 IYMMENNCSYANCFNECQMMEALTVVEETPSKVEKYRLFM 914 >07_01_0442 - 3348638-3349126,3349978-3350322 Length = 277 Score = 29.1 bits (62), Expect = 3.9 Identities = 14/48 (29%), Positives = 27/48 (56%) Frame = +1 Query: 127 LLGTLIKLHFVLQIVQHTFYSQFLNSILINTYPTIYKTTLL*SMKFIY 270 +L + +HF+ +I++ F Q+ S+ +NT TI + L+ + IY Sbjct: 100 VLSAALTVHFLKRILEVLFIHQYSGSMPLNTAATISSSYLVITATMIY 147 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,737,219 Number of Sequences: 37544 Number of extensions: 265042 Number of successful extensions: 487 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 478 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 486 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1980691104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -