BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11l14r (748 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_9398| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_20042| Best HMM Match : RYDR_ITPR (HMM E-Value=0) 28 9.2 >SB_9398| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 783 Score = 28.7 bits (61), Expect = 5.3 Identities = 22/71 (30%), Positives = 36/71 (50%), Gaps = 1/71 (1%) Frame = -2 Query: 426 STDNNVSYFNKMPSNQ*LKTSTVINEVVDKLEYARAFIQRFPATFS-VISFINVDKFHRL 250 ST N+V K+ + LKT + N+V+ L+ + + P+T + VIS + +D+ L Sbjct: 192 STSNDVISTLKLDLGRHLKTPSTSNDVISALKLDQGRHLKTPSTSNDVISALKLDQGRHL 251 Query: 249 K*SCFVNSRIS 217 K N IS Sbjct: 252 KTPSTSNDVIS 262 >SB_20042| Best HMM Match : RYDR_ITPR (HMM E-Value=0) Length = 340 Score = 27.9 bits (59), Expect = 9.2 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -2 Query: 126 LRNRFYDNSVCIFTVYIRLCSHIFHCTQ 43 LR F DNS + V R+ HI HC + Sbjct: 280 LRYIFMDNSALCYEVTERVVQHIIHCIE 307 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,777,574 Number of Sequences: 59808 Number of extensions: 364783 Number of successful extensions: 715 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 665 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 713 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2022185256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -