BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11l14r (748 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81139-6|CAH60791.2| 358|Caenorhabditis elegans Hypothetical pr... 28 6.1 Z78546-5|CAO79773.1| 962|Caenorhabditis elegans Hypothetical pr... 28 6.1 Z78546-4|CAB01771.3| 920|Caenorhabditis elegans Hypothetical pr... 28 6.1 >Z81139-6|CAH60791.2| 358|Caenorhabditis elegans Hypothetical protein W05H5.8 protein. Length = 358 Score = 28.3 bits (60), Expect = 6.1 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +3 Query: 612 LYLKIILKLHKCNACNAQVPTLISATFLKL 701 +++ L HK N C+AQ+P +IS L Sbjct: 181 IFVSFALLFHKINPCDAQLPWIISCVLTLL 210 >Z78546-5|CAO79773.1| 962|Caenorhabditis elegans Hypothetical protein T21H8.1b protein. Length = 962 Score = 28.3 bits (60), Expect = 6.1 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = +1 Query: 187 SQFLNSILINTYPTIYKTTLL*SMKFIYIDKRDHRKCSWKSLNKSPSI 330 S++ S++ PT+ LL F + RD R SW SL+ SPS+ Sbjct: 120 SKYTASLMTTGVPTL---PLLSMTPFNQLQSRDARGASWISLSPSPSM 164 >Z78546-4|CAB01771.3| 920|Caenorhabditis elegans Hypothetical protein T21H8.1a protein. Length = 920 Score = 28.3 bits (60), Expect = 6.1 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = +1 Query: 187 SQFLNSILINTYPTIYKTTLL*SMKFIYIDKRDHRKCSWKSLNKSPSI 330 S++ S++ PT+ LL F + RD R SW SL+ SPS+ Sbjct: 120 SKYTASLMTTGVPTL---PLLSMTPFNQLQSRDARGASWISLSPSPSM 164 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,331,006 Number of Sequences: 27780 Number of extensions: 299464 Number of successful extensions: 744 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 727 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 744 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1766990064 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -