BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11l14f (569 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 22 3.7 DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate r... 21 8.6 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 8.6 AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. 21 8.6 AB006152-1|BAA24504.1| 178|Apis mellifera inositol 1,4,5-tripho... 21 8.6 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 22.2 bits (45), Expect = 3.7 Identities = 9/26 (34%), Positives = 12/26 (46%) Frame = +1 Query: 427 NQDYGPERMFLYF*NGVKENSIYLIL 504 N DY E +YF + N+ Y L Sbjct: 211 NHDYNLENKLIYFIEDIGLNTYYFFL 236 >DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate receptor protein. Length = 322 Score = 21.0 bits (42), Expect = 8.6 Identities = 9/34 (26%), Positives = 18/34 (52%) Frame = +3 Query: 183 LSCPVSVFNKDFDNATSSGSA*PINVMKVVSLQL 284 +SC +S+F ++FD + + K + L+L Sbjct: 67 ISCLLSIFKQEFDETERASGDLSLG-QKTIDLEL 99 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.0 bits (42), Expect = 8.6 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +1 Query: 97 GGITAVTRVSGALCTLNSVLTFVMIMYVY*VVQFLF 204 GG+ VS L + + L+ V+++ V V+ F+F Sbjct: 983 GGVIESIMVSDYLPLVAATLSGVLVLLVIIVLAFVF 1018 >AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. Length = 226 Score = 21.0 bits (42), Expect = 8.6 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +2 Query: 302 GAATATIQSNRTIMALPTTLGATASFTAW 388 G+ T S+ + +PT + AT T W Sbjct: 177 GSNTIERNSHESXFVVPTRVPATCCTTXW 205 >AB006152-1|BAA24504.1| 178|Apis mellifera inositol 1,4,5-triphosphate recepter protein. Length = 178 Score = 21.0 bits (42), Expect = 8.6 Identities = 9/34 (26%), Positives = 18/34 (52%) Frame = +3 Query: 183 LSCPVSVFNKDFDNATSSGSA*PINVMKVVSLQL 284 +SC +S+F ++FD + + K + L+L Sbjct: 35 ISCLLSIFKQEFDETERASGDLSLG-QKTIDLEL 67 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,982 Number of Sequences: 438 Number of extensions: 3048 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16381902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -