BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11l10r (352 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 28 0.12 AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR prot... 24 1.9 AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein... 23 2.5 Y17702-1|CAA76822.2| 260|Anopheles gambiae putative gVAG protei... 23 3.3 AF457548-1|AAL68778.1| 178|Anopheles gambiae antigen 5-related ... 23 3.3 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 23 3.3 Z22930-6|CAA80518.1| 277|Anopheles gambiae trypsin protein. 23 4.4 Z18890-1|CAA79328.1| 277|Anopheles gambiae trypsin protein. 23 4.4 AY846632-1|AAW31598.1| 412|Anopheles gambiae SAGLIN protein. 22 5.8 AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 22 5.8 AJ000037-1|CAA03873.1| 94|Anopheles gambiae D3 protein protein. 22 5.8 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 22 7.6 AY146740-1|AAO12100.1| 139|Anopheles gambiae odorant-binding pr... 22 7.6 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 22 7.6 AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical prot... 22 7.6 AF026494-1|AAB81852.1| 113|Anopheles gambiae chitinase protein. 22 7.6 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 27.9 bits (59), Expect = 0.12 Identities = 13/27 (48%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = +1 Query: 250 TLSATCL-NCSSRDILCYLLRSGGRVV 327 T S TC NC+S ++ CYLL G V+ Sbjct: 938 TASTTCKKNCASDELDCYLLDDNGFVI 964 >AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR protein. Length = 502 Score = 23.8 bits (49), Expect = 1.9 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -1 Query: 82 RSNTSKMRRNST 47 RSN SKMRRN+T Sbjct: 468 RSNGSKMRRNTT 479 >AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein coupled receptor protein. Length = 459 Score = 23.4 bits (48), Expect = 2.5 Identities = 12/55 (21%), Positives = 30/55 (54%) Frame = -1 Query: 352 DTVPIGTLQLPYLLISKDNTKCLSTSNSNRSPIRLGTGRPSPVTMRTLRCTPCTS 188 ++ P+GTL ++I + + + + + + G+ +P+P+ R++ TP +S Sbjct: 254 NSFPLGTLLCVGIVICNLSVRKVLYQSHRKMCRQFGSIKPTPMLNRSMSQTPKSS 308 >Y17702-1|CAA76822.2| 260|Anopheles gambiae putative gVAG protein precursor protein. Length = 260 Score = 23.0 bits (47), Expect = 3.3 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 2/28 (7%) Frame = -1 Query: 274 NSNRSPIRLGTGRPSP--VTMRTLRCTP 197 N NRS I LG RP P V M TL P Sbjct: 74 NLNRSNIALGRIRPYPSAVKMPTLTWDP 101 >AF457548-1|AAL68778.1| 178|Anopheles gambiae antigen 5-related 1 protein protein. Length = 178 Score = 23.0 bits (47), Expect = 3.3 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 2/28 (7%) Frame = -1 Query: 274 NSNRSPIRLGTGRPSP--VTMRTLRCTP 197 N NRS I LG RP P V M TL P Sbjct: 74 NLNRSNIALGRIRPYPSAVKMPTLTWDP 101 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 23.0 bits (47), Expect = 3.3 Identities = 16/62 (25%), Positives = 22/62 (35%) Frame = -1 Query: 238 RPSPVTMRTLRCTPCTSRLP*VMLTLPSPAVLWRAPSGRHGTVAKASPKTMPRSNTSKMR 59 R +P T T +P + P + WR H T K T P + TS Sbjct: 668 RTTPTTTTTTTASPAPA--PAIRSRFGDNRPSWRPLIVPHATTTKTPTTTPPATTTSTTP 725 Query: 58 RN 53 R+ Sbjct: 726 RD 727 >Z22930-6|CAA80518.1| 277|Anopheles gambiae trypsin protein. Length = 277 Score = 22.6 bits (46), Expect = 4.4 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -1 Query: 133 PSGRHGTVAKASPKTMPR 80 PSGRH V P+ +PR Sbjct: 24 PSGRHHLVHPLLPRFLPR 41 >Z18890-1|CAA79328.1| 277|Anopheles gambiae trypsin protein. Length = 277 Score = 22.6 bits (46), Expect = 4.4 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -1 Query: 133 PSGRHGTVAKASPKTMPR 80 PSGRH V P+ +PR Sbjct: 24 PSGRHHLVHPLLPRFLPR 41 >AY846632-1|AAW31598.1| 412|Anopheles gambiae SAGLIN protein. Length = 412 Score = 22.2 bits (45), Expect = 5.8 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = -1 Query: 190 SRLP*VMLTLPSPAVLWRAPSGRHGT 113 SRLP V+L L S AVL A G+ T Sbjct: 2 SRLPTVLLLLASAAVL--AAGGQEAT 25 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 22.2 bits (45), Expect = 5.8 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = -1 Query: 103 ASPKTMPRSNTSK 65 +S K MPRS+TSK Sbjct: 237 SSSKNMPRSSTSK 249 >AJ000037-1|CAA03873.1| 94|Anopheles gambiae D3 protein protein. Length = 94 Score = 22.2 bits (45), Expect = 5.8 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = -1 Query: 190 SRLP*VMLTLPSPAVLWRAPSGRHGT 113 SRLP V+L L S AVL A G+ T Sbjct: 2 SRLPTVLLLLASAAVL--AAGGQEAT 25 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 21.8 bits (44), Expect = 7.6 Identities = 7/31 (22%), Positives = 15/31 (48%) Frame = +3 Query: 123 LPLGALHKTAGLGNVNITYGSLLVQGVQRKV 215 +PL +HK L + +L+ +Q ++ Sbjct: 890 IPLNKIHKKLALSTEESSINEILMNSIQEQI 920 >AY146740-1|AAO12100.1| 139|Anopheles gambiae odorant-binding protein AgamOBP9 protein. Length = 139 Score = 21.8 bits (44), Expect = 7.6 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = +2 Query: 191 CTGSTAQGSHRHWAW 235 C GS G+ HWA+ Sbjct: 104 CAGSNTDGNVCHWAF 118 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 21.8 bits (44), Expect = 7.6 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -1 Query: 337 GTLQLPYLLISKDNTKCLSTSNSNRSPIRLG 245 GT++ +LI K+ K L N+NR + G Sbjct: 710 GTIKRNGVLIQKEVLKILRQENNNRLDVADG 740 >AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical protein protein. Length = 765 Score = 21.8 bits (44), Expect = 7.6 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -1 Query: 337 GTLQLPYLLISKDNTKCLSTSNSNRSPIRLG 245 GT++ +LI K+ K L N+NR + G Sbjct: 711 GTIKRNGVLIQKEVLKILRQENNNRLDVADG 741 >AF026494-1|AAB81852.1| 113|Anopheles gambiae chitinase protein. Length = 113 Score = 21.8 bits (44), Expect = 7.6 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -3 Query: 101 ISQDDAKKQYIENAEKLHSKY 39 + A+K++IEN K KY Sbjct: 84 VRSSQARKRFIENVMKFIDKY 104 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 430,416 Number of Sequences: 2352 Number of extensions: 9341 Number of successful extensions: 26 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 25364985 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -