BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11l09r (753 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 23 2.6 AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 23 3.5 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 22 4.6 DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired pr... 21 8.0 DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped prot... 21 8.0 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 23.0 bits (47), Expect = 2.6 Identities = 13/49 (26%), Positives = 22/49 (44%) Frame = -2 Query: 590 TAAHCWRTRRAQARQFTLALGTANIFSGGTRVTTSNVQMHGSYNMDTLH 444 T A T+R + + TLA+ N + G + T G + ++LH Sbjct: 4 TGADRLMTQRCKEKLNTLAISVMNQWPGVRLLVTEGWDEEGYHTPESLH 52 >AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neuroblasts defectiveprotein protein. Length = 224 Score = 22.6 bits (46), Expect = 3.5 Identities = 12/26 (46%), Positives = 15/26 (57%), Gaps = 2/26 (7%) Frame = -3 Query: 547 SSPSLLAQLTSSPEAP--GSPPPMSR 476 SSP L +++ SP P SPPP R Sbjct: 83 SSPILAEKVSVSPTTPPTPSPPPEER 108 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 22.2 bits (45), Expect = 4.6 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -3 Query: 547 SSPSLLAQLTSSPEAPGSPPPMSR 476 S PS + ++ E PG PP R Sbjct: 980 SEPSETVTIITAEEVPGGPPTSIR 1003 >DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired protein. Length = 311 Score = 21.4 bits (43), Expect = 8.0 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -3 Query: 61 PASPESHPST 32 P SPE+HP T Sbjct: 37 PKSPENHPET 46 >DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped protein. Length = 126 Score = 21.4 bits (43), Expect = 8.0 Identities = 11/22 (50%), Positives = 13/22 (59%), Gaps = 3/22 (13%) Frame = +1 Query: 145 RGPPESPLQ---VLRPLEPSTQ 201 RGPP +PLQ V L+P Q Sbjct: 58 RGPPRTPLQPKLVAGKLKPKRQ 79 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,197 Number of Sequences: 336 Number of extensions: 3234 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20131186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -