BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11l07f (445 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 1e-08 SB_42441| Best HMM Match : DUF1484 (HMM E-Value=0.48) 42 3e-04 SB_33029| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 4.0 SB_37851| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.0 SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.0 SB_21275| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_14516| Best HMM Match : PH (HMM E-Value=6.8e-06) 27 9.2 >SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 849 Score = 56.4 bits (130), Expect = 1e-08 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = +3 Query: 48 MAKPKGERKGKSAINEVVTREYTVNLHKRLHGVGFKKR 161 M K ++KG+SAINEVVTREYT+NLHKR+HG+ R Sbjct: 769 MVKKTDKKKGRSAINEVVTREYTINLHKRIHGMNVPYR 806 Score = 54.4 bits (125), Expect = 4e-08 Identities = 33/100 (33%), Positives = 50/100 (50%), Gaps = 2/100 (2%) Frame = +3 Query: 123 LHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNKFLWSKGVR--NVPFXXXX 296 +H G F + K ++K +K+ + V TR K + NVP+ Sbjct: 750 IHNAARGCNFFLLLDFSFKMVKKTDKKKGRSAINEVVTREYTINLHKRIHGMNVPYRVRV 809 Query: 297 XXXXXXNDDEDSAHKLFTLVTYVPVASIKGLQTENVDASQ 416 N+DEDS HKL+TLVT V V++ KGLQT+ V++ + Sbjct: 810 RLARKRNEDEDSPHKLYTLVTSVAVSTFKGLQTQKVESEE 849 >SB_42441| Best HMM Match : DUF1484 (HMM E-Value=0.48) Length = 776 Score = 41.5 bits (93), Expect = 3e-04 Identities = 20/42 (47%), Positives = 25/42 (59%) Frame = +3 Query: 273 NVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKGLQTE 398 NVP+ N+DEDS HKL+TLVT V V++ K L E Sbjct: 2 NVPYRVRVRLARKRNEDEDSPHKLYTLVTSVAVSTFKVLADE 43 >SB_33029| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 927 Score = 27.9 bits (59), Expect = 4.0 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -1 Query: 268 TPLDQRNLFKRVSTRMSGVPICFSANF 188 TP D N R T M G+P+C +A F Sbjct: 285 TPEDTPNDSLRTKTVMFGIPVCMTARF 311 >SB_37851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 27.1 bits (57), Expect = 7.0 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = +3 Query: 72 KGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRK 191 K K INEV+T Y + L KR R IKE+ + Sbjct: 213 KNKPEINEVITPRYPPGEGEVLDDASIIKRYKRQIKELEE 252 >SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 402 Score = 27.1 bits (57), Expect = 7.0 Identities = 13/46 (28%), Positives = 20/46 (43%) Frame = +2 Query: 170 SNQRNPKVR*KTDGNSGHSSRHSLKQIPLV*GSQKCSLPCPCEAFT 307 S ++ ++ D GH + ++Q PL K LPC FT Sbjct: 349 SKKKKQGIQGSADAEQGHHEQSLVRQRPLFAPLPKLRLPCQYNPFT 394 >SB_21275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 327 Score = 26.6 bits (56), Expect = 9.2 Identities = 22/73 (30%), Positives = 32/73 (43%), Gaps = 3/73 (4%) Frame = +3 Query: 36 LKITMAKPKGERKGKSAINEVVTREYTVNLHKRLHGV-GFKKRAPRAIKEIRKFAE--KQ 206 + + + K K R+ NE + REY LHK L + F PR R + KQ Sbjct: 91 IALVIEKDKSLRRKIEEENEQLKREYLQQLHKTLEALRTFDFNNPRDAIFKRNLVKMHKQ 150 Query: 207 MGTPDIRVDTRLN 245 +G +RV +N Sbjct: 151 VGNYCLRVYGEMN 163 >SB_14516| Best HMM Match : PH (HMM E-Value=6.8e-06) Length = 438 Score = 26.6 bits (56), Expect = 9.2 Identities = 20/69 (28%), Positives = 29/69 (42%) Frame = -1 Query: 253 RNLFKRVSTRMSGVPICFSANFRISLIALGARFLNPTP*SRLCKLTVYSRVTTSFMADLP 74 RNL KRV R P C + R + + L R CK +V S +T+ + Sbjct: 214 RNLAKRVHERFGDAPGCEFRHRRRNSGVGTSEILTDCSGERSCKRSVTSNRSTNSSSKER 273 Query: 73 FLSPLGLAI 47 ++ PL I Sbjct: 274 WMGPLASCI 282 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,139,767 Number of Sequences: 59808 Number of extensions: 252022 Number of successful extensions: 439 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 425 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 438 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 871599479 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -