BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11l05f (472 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16818| Best HMM Match : Prefoldin (HMM E-Value=0.00051) 64 7e-11 SB_24029| Best HMM Match : Kinesin (HMM E-Value=2.10195e-44) 29 1.9 SB_56523| Best HMM Match : Pox_A_type_inc (HMM E-Value=0) 28 3.4 SB_43840| Best HMM Match : NDK (HMM E-Value=0) 27 5.9 SB_23205| Best HMM Match : Helicase_C (HMM E-Value=3.9e-14) 27 7.8 >SB_16818| Best HMM Match : Prefoldin (HMM E-Value=0.00051) Length = 162 Score = 63.7 bits (148), Expect = 7e-11 Identities = 29/48 (60%), Positives = 41/48 (85%) Frame = +3 Query: 117 ANVMLEYSLEDAEKLLTTNMETAQENLNQVEHDLDFLRDQCTTTEVNM 260 ANVMLEYS+++AE+LL N++TA ++L ++E DL FLRDQ TTTEV++ Sbjct: 92 ANVMLEYSIDEAEELLQKNLKTAIKSLEELEDDLGFLRDQYTTTEVSI 139 >SB_24029| Best HMM Match : Kinesin (HMM E-Value=2.10195e-44) Length = 534 Score = 29.1 bits (62), Expect = 1.9 Identities = 21/64 (32%), Positives = 29/64 (45%), Gaps = 1/64 (1%) Frame = +3 Query: 6 EKLKEQKEEVETQFLLSDQVFVK-ANVPPTKSVCLWLGANVMLEYSLEDAEKLLTTNMET 182 + K KEE+E Q L Q F V + + +LE +++DA L T N E Sbjct: 407 DSYKRHKEEMEIQQLQHFQTFRNYREVFEDQKSAIEQRYRTLLEEAIQDAVFLSTRNQEL 466 Query: 183 AQEN 194 QEN Sbjct: 467 LQEN 470 >SB_56523| Best HMM Match : Pox_A_type_inc (HMM E-Value=0) Length = 2858 Score = 28.3 bits (60), Expect = 3.4 Identities = 16/74 (21%), Positives = 38/74 (51%), Gaps = 1/74 (1%) Frame = +3 Query: 18 EQKEEVETQFLLSDQVFVKANVPPTKSVCLWLGANVMLEYSLEDAE-KLLTTNMETAQEN 194 E++ E++++ + + + P + + + M+E S +D E ++L ++ET Q Sbjct: 1576 EKENELQSKLSQAHEQIINLENRPQLESAISMVSESMVESSGDDMETQILRQDLETLQSK 1635 Query: 195 LNQVEHDLDFLRDQ 236 +++E L+DQ Sbjct: 1636 YDKLERQNKLLQDQ 1649 >SB_43840| Best HMM Match : NDK (HMM E-Value=0) Length = 786 Score = 27.5 bits (58), Expect = 5.9 Identities = 13/37 (35%), Positives = 23/37 (62%) Frame = -3 Query: 317 GNATRSCLAFLHIPVVNSSHIHFGSGTLIS*EIQIMF 207 G+ATR+ A +H+ V SSH F + +S ++++ F Sbjct: 413 GSATRA--AGIHVSVTQSSHRGFDNYAFVSRQVEVSF 447 >SB_23205| Best HMM Match : Helicase_C (HMM E-Value=3.9e-14) Length = 1197 Score = 27.1 bits (57), Expect = 7.8 Identities = 15/70 (21%), Positives = 31/70 (44%) Frame = +3 Query: 108 WLGANVMLEYSLEDAEKLLTTNMETAQENLNQVEHDLDFLRDQCTTTEVNMARVYNWDVK 287 WL + YS++++ + N A+E ++ +E +L+ +Q E + V+ Sbjct: 1115 WLAELGPMFYSVKESTRSRAENRRRAKEEMSAMERELEEASEQIKAREQEKLNKHVASVR 1174 Query: 288 KRQAASGRIT 317 + GR T Sbjct: 1175 TKIVTPGRKT 1184 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,270,395 Number of Sequences: 59808 Number of extensions: 219933 Number of successful extensions: 573 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 548 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 573 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 982083920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -