BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11l01f (573 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7038| Best HMM Match : No HMM Matches (HMM E-Value=.) 248 2e-66 SB_58212| Best HMM Match : 7tm_1 (HMM E-Value=1.7e-38) 29 2.0 SB_26423| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_35269| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_37049| Best HMM Match : Acylphosphatase (HMM E-Value=0.82) 29 3.6 SB_20414| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_51402| Best HMM Match : Peptidase_M13_N (HMM E-Value=1.9e-12) 27 8.2 SB_36174| Best HMM Match : Transposase_11 (HMM E-Value=0.00013) 27 8.2 >SB_7038| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 248 bits (607), Expect = 2e-66 Identities = 114/161 (70%), Positives = 132/161 (81%) Frame = +3 Query: 27 RVRMSSLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAV 206 +V + +L+LQKRLAAS+++CGKKK+WLDPNE NEIAN NSRQN+RK+IKDGL+IKKP V Sbjct: 26 KVHVGTLRLQKRLAASLLKCGKKKIWLDPNECNEIANANSRQNVRKLIKDGLIIKKPEIV 85 Query: 207 HSRARVRKNTEARRKGRHCGFGKRRGTANARMPQKELWXXXXXXXXXXXXXXXTAKKIDR 386 HSRARVRK EAR KGRH G GKR+GTANARMPQK +W AKKID Sbjct: 86 HSRARVRKADEARSKGRHSGHGKRKGTANARMPQKTIWIRRMRVLRRLLRKYREAKKIDN 145 Query: 387 HLYHSLYMKAKGNVFKNKRVLMEYIHRKKAEKARTKMLSDQ 509 H+YHSLYMK+KGNVFKNKRVLMEYIH+KKAEKAR+K+LSDQ Sbjct: 146 HMYHSLYMKSKGNVFKNKRVLMEYIHKKKAEKARSKLLSDQ 186 >SB_58212| Best HMM Match : 7tm_1 (HMM E-Value=1.7e-38) Length = 352 Score = 29.5 bits (63), Expect = 2.0 Identities = 23/84 (27%), Positives = 38/84 (45%), Gaps = 6/84 (7%) Frame = -2 Query: 302 HTRIGSTSSLTKATVTTLST----CLCVFADTGAGVDCYRFLDDETILDHLTD-VLSGVG 138 +T +G S+ T+T LS CL + G + + L T+ +L+ + Sbjct: 5 NTSVGYNSTSAGFTITDLSLLPAYCLAISVGLGGNGLVIGVVRKKRSLHTTTNYLLANLA 64 Query: 137 VCDLIDFIWIQPHLLFT-TSHNRG 69 + DL++ IW P L+ T H RG Sbjct: 65 LADLLNLIWCIPGLVLTFVEHPRG 88 >SB_26423| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 29.1 bits (62), Expect = 2.7 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +3 Query: 213 RARVRKNTEARRKGRHCGFGKRRGTANAR 299 +A RK RR+ R G K+R TANAR Sbjct: 17 KANSRKKRRRRRRPRLTGLSKQRQTANAR 45 >SB_35269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 28.7 bits (61), Expect = 3.6 Identities = 12/43 (27%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = -1 Query: 342 LEPFVFVPIVPSVAY--AHWQYLFSYQSHSDDPFYVPLCFCGH 220 ++ + F+P V + W++ ++ H+DDPF V C H Sbjct: 72 IKDYSFLPCCFKVCHRTCFWRWAHNHSIHADDPFEVACPHCRH 114 >SB_37049| Best HMM Match : Acylphosphatase (HMM E-Value=0.82) Length = 646 Score = 28.7 bits (61), Expect = 3.6 Identities = 12/43 (27%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = -1 Query: 342 LEPFVFVPIVPSVAY--AHWQYLFSYQSHSDDPFYVPLCFCGH 220 ++ + F+P V + W++ ++ H+DDPF V C H Sbjct: 72 IKDYSFLPCCFKVCHRTCFWRWAHNHSIHADDPFEVACPHCRH 114 >SB_20414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 358 Score = 28.3 bits (60), Expect = 4.7 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -1 Query: 390 DACQSSWQFCTSGAIFLEPF-VFVPIVPSVAYAHW 289 D + S Q C FLEP VF P+ PS A+AH+ Sbjct: 192 DIVEKSQQACREHEAFLEPMGVFSPLPPS-AHAHF 225 >SB_51402| Best HMM Match : Peptidase_M13_N (HMM E-Value=1.9e-12) Length = 1206 Score = 27.5 bits (58), Expect = 8.2 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -1 Query: 405 RVSGIDACQSSWQFCTSGAIFLEPFVF 325 RV+G+ S WQ CT+ A L+ VF Sbjct: 493 RVAGVKKSPSRWQQCTNAANNLDGLVF 519 >SB_36174| Best HMM Match : Transposase_11 (HMM E-Value=0.00013) Length = 427 Score = 27.5 bits (58), Expect = 8.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -2 Query: 71 GCKPLLQLEGTHPDTVRSNAHKK 3 GCKP L HPDT + A+ + Sbjct: 336 GCKPFLMTPFPHPDTPKQEAYNE 358 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,145,785 Number of Sequences: 59808 Number of extensions: 423649 Number of successful extensions: 1182 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1117 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1181 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1361520496 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -