BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11k21r (766 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC25B8.13c |isp7||2-OG-Fe|Schizosaccharomyces pombe|chr 1|||Ma... 27 2.2 SPCC16C4.09 |sts5|orb4|RNB-like protein|Schizosaccharomyces pomb... 27 3.9 SPBC725.07 |pex5||peroxisomal targeting signal receptor |Schizos... 27 3.9 SPBC106.17c |cys2||O-acetyltransferase |Schizosaccharomyces pomb... 25 9.0 SPBC1105.01 |rrp12|SPBPB7E8.03|rRNA processing protein Rrp12|Sch... 25 9.0 >SPAC25B8.13c |isp7||2-OG-Fe|Schizosaccharomyces pombe|chr 1|||Manual Length = 397 Score = 27.5 bits (58), Expect = 2.2 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 Query: 177 NSARDRYTVPWGFNGFINYI 236 NS DRYT+P+ G I+Y+ Sbjct: 339 NSGSDRYTIPFFLQGNIDYV 358 >SPCC16C4.09 |sts5|orb4|RNB-like protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 1066 Score = 26.6 bits (56), Expect = 3.9 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = -1 Query: 763 TPWTHTTPVARXP---XLYAHYLSLKTRTGMVVAGSGSTLH 650 TPW TTP A P L H L+ TG++ A S +H Sbjct: 40 TPWLQTTPSANRPTWLPLQQHMHQLR-HTGLLPAVESSFVH 79 >SPBC725.07 |pex5||peroxisomal targeting signal receptor |Schizosaccharomyces pombe|chr 2|||Manual Length = 598 Score = 26.6 bits (56), Expect = 3.9 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -1 Query: 376 RFLSTYQFYLRVTSSATSEDINLDYFSNKAK 284 R +S Y+RV S+ +INL YF + AK Sbjct: 497 RAVSLQPQYVRVRSNMAVSNINLGYFEDAAK 527 >SPBC106.17c |cys2||O-acetyltransferase |Schizosaccharomyces pombe|chr 2|||Manual Length = 504 Score = 25.4 bits (53), Expect = 9.0 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = -3 Query: 176 KVKPGFEKYYVLSSFQCSSGCMYPNYTV 93 K+ GF+K+Y F C G + P + + Sbjct: 76 KIVSGFKKFYHNKPFLCDHGGILPKFEI 103 >SPBC1105.01 |rrp12|SPBPB7E8.03|rRNA processing protein Rrp12|Schizosaccharomyces pombe|chr 2|||Manual Length = 1001 Score = 25.4 bits (53), Expect = 9.0 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 Query: 350 IKLICR*KSQKKCSLLSPKIKHMCNKLIKYW 442 IKLI + S++ +L I +C+ LI YW Sbjct: 249 IKLILKVLSERIDALSDAVIYELCDSLIPYW 279 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,048,416 Number of Sequences: 5004 Number of extensions: 61595 Number of successful extensions: 140 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 138 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 140 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 367316502 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -