BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11k21f (643 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29190| Best HMM Match : No HMM Matches (HMM E-Value=.) 241 3e-64 SB_22642| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_34973| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.60 SB_912| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.60 SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.80 SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) 31 1.1 SB_34751| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_56471| Best HMM Match : RVT_1 (HMM E-Value=0.00041) 30 1.4 SB_38055| Best HMM Match : zf-CW (HMM E-Value=1.9) 30 1.8 SB_17592| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_53929| Best HMM Match : Amelogenin (HMM E-Value=3.6) 29 2.4 SB_51968| Best HMM Match : PT (HMM E-Value=0.54) 29 2.4 SB_44788| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_16587| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.69) 29 2.4 SB_37047| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 29 3.2 SB_21973| Best HMM Match : XPG_N (HMM E-Value=0.013) 29 3.2 SB_5574| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_4395| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_51309| Best HMM Match : LicD (HMM E-Value=0.0069) 29 4.2 SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_45600| Best HMM Match : LTXXQ (HMM E-Value=1.8) 29 4.2 SB_59186| Best HMM Match : rve (HMM E-Value=0.00029) 28 5.6 SB_8467| Best HMM Match : rve (HMM E-Value=2.4e-13) 28 5.6 SB_1237| Best HMM Match : rve (HMM E-Value=0.00029) 28 5.6 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_22858| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_17285| Best HMM Match : rve (HMM E-Value=1.3e-16) 27 9.8 SB_14361| Best HMM Match : Dynactin_p62 (HMM E-Value=0.00091) 27 9.8 >SB_29190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 241 bits (591), Expect = 3e-64 Identities = 123/149 (82%), Positives = 134/149 (89%) Frame = +1 Query: 121 NNPIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGII 300 + P Y FFGVMGA +A++FSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGII Sbjct: 5 DQPSYVAFFGVMGATAAMVFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGII 64 Query: 301 AIYGLVVAVLIAGALQEPANYPLYKGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQ 480 AIYGLVVAVLI ++ + +Y LYK F+ LGAGL+VG SGLAAGFAIGIVGDAGVRGTAQ Sbjct: 65 AIYGLVVAVLIGSSISK--DYTLYKSFLDLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQ 122 Query: 481 QPRLFVGMILILIFAEVLGLYGLIVAIYL 567 QPRLFVGMILILIFAEVLGLYGLIVA+ L Sbjct: 123 QPRLFVGMILILIFAEVLGLYGLIVALIL 151 >SB_22642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1574 Score = 33.9 bits (74), Expect = 0.11 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 3/55 (5%) Frame = -1 Query: 604 REWCVF---RAFILCTGRWRR*VRKDPILQRK*E*ESFRRIT*AAEQYHARLHLP 449 R WCV+ R+ I CT RW R V P + + +S RR+ E + L+ P Sbjct: 931 RGWCVYHMGRSLIACTRRWMRKVACSPSKETRPHRQSSRRLASQQESQQSLLNAP 985 >SB_34973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 427 Score = 31.5 bits (68), Expect = 0.60 Identities = 33/122 (27%), Positives = 51/122 (41%), Gaps = 4/122 (3%) Frame = +1 Query: 7 LGHICLCKSSFVE*VCADSHHSF--WDL*ILPHLTNKMAENNPIYGPFFGVMGAASAIIF 180 L H+ L KS + C DS HSF W +L + N P+ P A S + Sbjct: 285 LNHLVLPKSRKKKISCVDSLHSFAQWQNVMLETIYTNQVLNFPLAEP------AVSGLYG 338 Query: 181 SALGAAYGTAKSGTGIAAMSVMRP--ELIMKSIIPVVMAGIIAIYGLVVAVLIAGALQEP 354 S + A T + G A S++ P + + ++ VM GI + L A + ++P Sbjct: 339 SGVAALGITEQLQKGQEASSIVHPSDHDLYQRLMDAVMEGIHKVESLSSASKKESSKEKP 398 Query: 355 AN 360 N Sbjct: 399 KN 400 >SB_912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 31.5 bits (68), Expect = 0.60 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +1 Query: 391 GAGLAVGFSGLAAGFAIGIVG 453 GAG+ VGF LA G +G+VG Sbjct: 46 GAGMTVGFCNLACGICVGLVG 66 >SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3261 Score = 31.1 bits (67), Expect = 0.80 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = +3 Query: 273 HSCRHGGYYCHLRSGRGCPDCWCPPGASQLPPLQRV 380 + CR+ G C + R P C CPPG QRV Sbjct: 2981 YKCRYQGEVC-VTDSRNVPRCVCPPGCPPAEVSQRV 3015 >SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) Length = 295 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = -3 Query: 512 IRIIPTNNLGC*AVPRTPASPTMPMAKPAARPENPTAKPAP 390 ++I+P N + PR P + T P P P PT P P Sbjct: 205 VKILPGNGVVPTQAPRPPTTQTPPTKAPTDPPVPPTNPPVP 245 >SB_34751| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1143 Score = 30.7 bits (66), Expect = 1.1 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = -2 Query: 438 GETGSQTRESYSQTSTQVDEPFVKGVVGWLLEGTSNQDSHDQTV 307 G+ +T SYS S+QV +PF V +QD H+QT+ Sbjct: 713 GDVQKETTGSYSCNSSQVFDPFTLQCVNLPQPIKQHQDKHNQTL 756 Score = 29.9 bits (64), Expect = 1.8 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = -2 Query: 438 GETGSQTRESYSQTSTQVDEPFVKGVVGWLLEGTSNQDSHDQTV 307 G+ +T SYS S+QV +PF V +QD H+QT+ Sbjct: 44 GDVQKETTGSYSCNSSQVFDPFTLQCVNLPQLIKQHQDKHNQTL 87 >SB_56471| Best HMM Match : RVT_1 (HMM E-Value=0.00041) Length = 1155 Score = 30.3 bits (65), Expect = 1.4 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -3 Query: 464 TPASPTMPMAKPAARPENPTAKPAPKWMNPL 372 TPA PT+PMA A + P+ PA PL Sbjct: 1095 TPALPTIPMAPSGAPAKTPSVAPAAPSPRPL 1125 >SB_38055| Best HMM Match : zf-CW (HMM E-Value=1.9) Length = 439 Score = 29.9 bits (64), Expect = 1.8 Identities = 18/59 (30%), Positives = 24/59 (40%), Gaps = 2/59 (3%) Frame = -1 Query: 472 YHARLHLPRCLWRNRQPDQRILQPNQHPSG*TLCKGGSWLAPGGHQQSGQ--PRPDRRW 302 YHA+ + +C ++P +L Q S C PGGHQ Q R RW Sbjct: 264 YHAKNQVVKCYQPGKEPGGHLLPTYQAKSQAVKCYYIPGKEPGGHQAKNQAVTRQRTRW 322 >SB_17592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3592 Score = 29.5 bits (63), Expect = 2.4 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = -1 Query: 457 HLPRCLWRNRQPDQRILQPNQHPSG*TLCKGGSWLAPG-GHQQSGQ 323 ++ +++ Q +Q +L NQ PS T+ GGS G GH GQ Sbjct: 2347 YVSHTVFKREQDEQLLLWLNQRPSDWTMTWGGSGTIYGWGHNHRGQ 2392 >SB_53929| Best HMM Match : Amelogenin (HMM E-Value=3.6) Length = 156 Score = 29.5 bits (63), Expect = 2.4 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = -3 Query: 461 PASPTMPMAKPAARPENPTAKPAPK 387 PA+P P A PAA P PTA PA + Sbjct: 52 PAAPVTPTAAPAA-PVTPTAAPAAR 75 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = -3 Query: 461 PASPTMPMAKPAARPENPTAKPA 393 PA+P P A PAAR PTA PA Sbjct: 62 PAAPVTPTAAPAAR-VTPTAAPA 83 >SB_51968| Best HMM Match : PT (HMM E-Value=0.54) Length = 514 Score = 29.5 bits (63), Expect = 2.4 Identities = 18/56 (32%), Positives = 24/56 (42%) Frame = -3 Query: 539 RPNTSAKIRIRIIPTNNLGC*AVPRTPASPTMPMAKPAARPENPTAKPAPKWMNPL 372 +P T+ K R PT +L + +PT AKP PT +P K PL Sbjct: 135 KPKTTVKRRPTERPTKSLLPEEEEKERQTPTPTKAKPTTIKRRPTERPTKKPTKPL 190 >SB_44788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 979 Score = 29.5 bits (63), Expect = 2.4 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 273 HSCRHGGYYCHLRSGRGCPDCW 338 +SC G YYC++ RG DCW Sbjct: 348 YSCNSGHYYCYV---RGSNDCW 366 >SB_16587| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.69) Length = 404 Score = 29.5 bits (63), Expect = 2.4 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = -3 Query: 461 PASPTMPMAKPAARPENPTAKPAPK 387 PA+P P A PAA P PTA PA + Sbjct: 209 PAAPVTPTAAPAA-PVTPTAAPAAR 232 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = -3 Query: 461 PASPTMPMAKPAARPENPTAKPA 393 PA+P P A PAAR PTA PA Sbjct: 219 PAAPVTPTAAPAAR-VTPTAAPA 240 >SB_37047| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) Length = 233 Score = 29.1 bits (62), Expect = 3.2 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = -3 Query: 500 PTNNLGC*AVPRTPASP--TMPMAKPAARPENPTAKPAP 390 P+NN G A P TPA+P M +A P+ T P P Sbjct: 87 PSNNFGTPATPATPATPAHNMGVAGPSGMATPGTFIPPP 125 >SB_21973| Best HMM Match : XPG_N (HMM E-Value=0.013) Length = 611 Score = 29.1 bits (62), Expect = 3.2 Identities = 32/122 (26%), Positives = 50/122 (40%), Gaps = 4/122 (3%) Frame = +1 Query: 7 LGHICLCKSSFVE*VCADSHHSF--WDL*ILPHLTNKMAENNPIYGPFFGVMGAASAIIF 180 L H+ L +S + C DS HSF W +L + N P+ P A S + Sbjct: 469 LNHLVLPESREKKISCVDSLHSFAQWQNVMLETIYTNQVLNFPLAEP------AVSGLYG 522 Query: 181 SALGAAYGTAKSGTGIAAMSVMRP--ELIMKSIIPVVMAGIIAIYGLVVAVLIAGALQEP 354 S + A T + G A S++ P + + + VM GI + L A + ++P Sbjct: 523 SGVAALGITEQLQKGQKASSIVHPLDHDLYQRLRDAVMEGICKVESLSSASKKESSKEKP 582 Query: 355 AN 360 N Sbjct: 583 KN 584 >SB_5574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 388 Score = 29.1 bits (62), Expect = 3.2 Identities = 17/65 (26%), Positives = 24/65 (36%), Gaps = 3/65 (4%) Frame = -2 Query: 321 HDQTVDGNNTRHDDRNDRLHDQLRP---HHRHXXXXXXXXXXXXXXXXGAEDDSRRRPHN 151 HD T T D + +HD R + RH D +R PHN Sbjct: 304 HDTTRTARYTTRLDTDRTIHDTARHGPLYTRHGSIRTAQYTTRLDTDRSIHDTARYGPHN 363 Query: 150 SKEGS 136 +++GS Sbjct: 364 TRQGS 368 >SB_4395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 29.1 bits (62), Expect = 3.2 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = -2 Query: 636 IMSIEARSTGDGSGVCSGRLFCVQVDGDDKSVKTQYFSENKNKN 505 + ++ +STGD S VC G +F D K + Q E K N Sbjct: 15 LSALNKKSTGDKSWVCFGNMFMKLPDSKTKDMIIQGLQEVKGFN 58 >SB_51309| Best HMM Match : LicD (HMM E-Value=0.0069) Length = 466 Score = 28.7 bits (61), Expect = 4.2 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = +2 Query: 125 IQSTDPSLELWGRRLLSSSAPWELPMEL 208 I S D LELWG R LS+SA LP EL Sbjct: 355 ILSGDFYLELWGARELSNSALNFLPAEL 382 >SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1870 Score = 28.7 bits (61), Expect = 4.2 Identities = 13/34 (38%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = -3 Query: 473 VPRTPAS-PTMPMAKPAARPENPTAKPAPKWMNP 375 +P TP P P P RP PT +P P P Sbjct: 1354 IPSTPRPRPPTPPRPPTPRPRPPTPRPGPPTPRP 1387 >SB_45600| Best HMM Match : LTXXQ (HMM E-Value=1.8) Length = 355 Score = 28.7 bits (61), Expect = 4.2 Identities = 23/84 (27%), Positives = 39/84 (46%), Gaps = 2/84 (2%) Frame = -3 Query: 497 TNNLGC*AVPRTPASPTMPMAKPA--ARPENPTAKPAPKWMNPL*RG*LAGSWRAPAIRT 324 +NN G A P TPA+ +P+A P+ A P T PAP + P A + ++ Sbjct: 220 SNNFGTPATPATPAN-GVPIAGPSGMATPGAFTPPPAPVFTPPPPYRTTAKPFPKMSLTP 278 Query: 323 ATTRP*MAIIPAMTTGMIDFMISS 252 +P + P +T ++ ++ S Sbjct: 279 TPKKPPVPKKPVLTPAQLEGLLKS 302 >SB_59186| Best HMM Match : rve (HMM E-Value=0.00029) Length = 346 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -3 Query: 464 TPASPTMPMAKPAARPENPTAKPAPKWMNPL 372 TPA PT+P A A + P+ PA PL Sbjct: 286 TPALPTIPQAPSGAPAKTPSVAPAAPSPRPL 316 >SB_8467| Best HMM Match : rve (HMM E-Value=2.4e-13) Length = 347 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -3 Query: 464 TPASPTMPMAKPAARPENPTAKPAPKWMNPL 372 TPA PT+P A A + P+ PA PL Sbjct: 290 TPALPTIPQAPSGAPAKTPSVAPAAPSPRPL 320 >SB_1237| Best HMM Match : rve (HMM E-Value=0.00029) Length = 1026 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -3 Query: 464 TPASPTMPMAKPAARPENPTAKPAPKWMNPL 372 TPA PT+P A A + P+ PA PL Sbjct: 966 TPALPTIPQAPSGAPAKTPSVAPAAPSPRPL 996 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 27.9 bits (59), Expect = 7.4 Identities = 22/76 (28%), Positives = 27/76 (35%), Gaps = 2/76 (2%) Frame = -3 Query: 608 ATGVVCVQGVYFVYR*MATISP*RPNTSAKIRIRIIPTNNLGC*AVPRTPASPTM--PMA 435 AT V + Y + SP P S P A P PA+P P Sbjct: 29 ATTVTTTTANFTYYPHFISSSPPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPP 88 Query: 434 KPAARPENPTAKPAPK 387 P P P A+PAP+ Sbjct: 89 PPLPAPPPPPAQPAPQ 104 >SB_22858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1404 Score = 27.9 bits (59), Expect = 7.4 Identities = 16/56 (28%), Positives = 33/56 (58%) Frame = +1 Query: 178 FSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAGAL 345 +S + A G + G+ ++V+ + + +I V+ IIA+ G++VAV++A A+ Sbjct: 786 YSVIVAVVGVIIAVVGVI-IAVVGVIIAVVGVIIAVVGVIIAVVGVIVAVVVATAV 840 >SB_17285| Best HMM Match : rve (HMM E-Value=1.3e-16) Length = 560 Score = 27.5 bits (58), Expect = 9.8 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -3 Query: 464 TPASPTMPMAKPAARPENPTAKPA 393 TPA PT+P A A E P PA Sbjct: 448 TPALPTIPQAPSGAPAETPPVAPA 471 >SB_14361| Best HMM Match : Dynactin_p62 (HMM E-Value=0.00091) Length = 497 Score = 27.5 bits (58), Expect = 9.8 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -2 Query: 333 NQDSHDQTVDGNNTRHDDRNDRLHDQL 253 N D+ D D NN DD ND +D + Sbjct: 140 NDDNDDNNNDSNNNSDDDGNDDTNDYI 166 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,583,885 Number of Sequences: 59808 Number of extensions: 523835 Number of successful extensions: 1911 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 1546 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1882 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1620947750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -