BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11k19r (439 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 24 2.1 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 24 2.7 AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript... 23 6.3 AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein ... 22 8.3 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 24.2 bits (50), Expect = 2.1 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +2 Query: 230 SSERTLGEVRVILMRWIGETSAWGFSMS 313 S R LG RV++ ++ G SA+G +++ Sbjct: 513 SIARQLGMARVVMHKYAGILSAYGMALA 540 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 23.8 bits (49), Expect = 2.7 Identities = 16/39 (41%), Positives = 18/39 (46%) Frame = -3 Query: 305 RNPRQRSPLSTASGSLLLXPMCARSRRSVLT*SMEPRNR 189 RNPR+RSP S P R RS S PR+R Sbjct: 255 RNPRRRSPRSGGRWPSCRSPPARRRSRSTRPTSW-PRSR 292 >AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase protein. Length = 1209 Score = 22.6 bits (46), Expect = 6.3 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +3 Query: 60 RSLSCGFSSENDPRSLNLHHKEFYGW 137 R C E + R N++ +EFY W Sbjct: 377 RYAECSKRKEQN-RMFNINEREFYNW 401 >AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein protein. Length = 699 Score = 22.2 bits (45), Expect = 8.3 Identities = 8/30 (26%), Positives = 16/30 (53%) Frame = +1 Query: 133 GGDTQDLGWHANWALYTQLLFLGSIDXVST 222 G T + W ++W++++ G+I ST Sbjct: 194 GNRTLYMSWPSSWSVFSSASQRGAISFAST 223 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 465,306 Number of Sequences: 2352 Number of extensions: 9619 Number of successful extensions: 16 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 36568146 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -