BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11k19r (439 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL132876-13|CAD21665.1| 117|Caenorhabditis elegans Hypothetical... 161 2e-40 U67947-1|AAB07557.2| 1147|Caenorhabditis elegans Hypothetical pr... 29 1.5 AF038609-2|AAK29794.1| 226|Caenorhabditis elegans Hypothetical ... 27 6.0 AF038609-1|AAO61425.1| 234|Caenorhabditis elegans Hypothetical ... 27 6.0 >AL132876-13|CAD21665.1| 117|Caenorhabditis elegans Hypothetical protein Y105E8A.16 protein. Length = 117 Score = 161 bits (392), Expect = 2e-40 Identities = 71/92 (77%), Positives = 85/92 (92%) Frame = -2 Query: 276 HRIRITLTSPNVRSLEKVCADXINGAKKQKLRVKGPVRMPTKILRITTRKTPCGEGSKTW 97 HRIR+TLTS NV+ LEKVCA I+GAK + L VKGP+RMPTK+LRITTRKTPCGEGSKTW Sbjct: 17 HRIRLTLTSQNVKPLEKVCAQLIDGAKNEHLIVKGPIRMPTKVLRITTRKTPCGEGSKTW 76 Query: 96 DRFQMRIHKRVIDLHSPSEIVKQITSINIEPG 1 DRFQMRIHKR+I+LH+P+E+++QITSI+IEPG Sbjct: 77 DRFQMRIHKRLINLHAPAEVLRQITSISIEPG 108 >U67947-1|AAB07557.2| 1147|Caenorhabditis elegans Hypothetical protein H03E18.1 protein. Length = 1147 Score = 29.1 bits (62), Expect = 1.5 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = -2 Query: 234 LEKVCADXINGAKKQKLRVKGPVRMPTKILRITTRKTPCGE 112 +E V A + G KK+ + K + PTK +T++ P E Sbjct: 359 VELVTAKTVEGEKKETKKPKSTTKKPTKTAAASTKRPPTTE 399 >AF038609-2|AAK29794.1| 226|Caenorhabditis elegans Hypothetical protein C54E4.2a protein. Length = 226 Score = 27.1 bits (57), Expect = 6.0 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = -2 Query: 339 MAAAVVSGKDIEKPQAEVSPIH 274 ++AA +S +D+EKP + P+H Sbjct: 14 ISAAYISSEDLEKPSSADKPVH 35 >AF038609-1|AAO61425.1| 234|Caenorhabditis elegans Hypothetical protein C54E4.2b protein. Length = 234 Score = 27.1 bits (57), Expect = 6.0 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = -2 Query: 339 MAAAVVSGKDIEKPQAEVSPIH 274 ++AA +S +D+EKP + P+H Sbjct: 14 ISAAYISSEDLEKPSSADKPVH 35 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,201,833 Number of Sequences: 27780 Number of extensions: 212632 Number of successful extensions: 460 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 448 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 460 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 745968860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -