BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11k17r (755 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3A11.07 |||NADH dehydrogenase|Schizosaccharomyces pombe|chr ... 29 0.54 SPAC25B8.16 |||RNase P and RNase MRP subunit |Schizosaccharomyce... 27 2.2 SPAC4D7.13 |usp104|prp40|U1 snRNP-associated protein Usp104|Schi... 27 2.9 SPBC13G1.14c |||RNA-binding protein|Schizosaccharomyces pombe|ch... 27 3.8 SPCC4G3.18 |||conserved fungal family|Schizosaccharomyces pombe|... 26 5.0 SPBC13E7.02 |cwf24||GCN5-related N acetyltransferase|Schizosacch... 26 5.0 SPAC11D3.05 |||membrane transporter|Schizosaccharomyces pombe|ch... 26 6.7 SPBC23G7.07c |||replication regulator |Schizosaccharomyces pombe... 26 6.7 >SPAC3A11.07 |||NADH dehydrogenase|Schizosaccharomyces pombe|chr 1|||Manual Length = 551 Score = 29.5 bits (63), Expect = 0.54 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = -3 Query: 597 PTTTTFQLLPVSMENSTILHTVALSLDLPVAVSPVKYLMFTLLL 466 P+ T +L ++IL T+ SL + VSP Y +FT LL Sbjct: 89 PSKKTLVVLGAGWGATSILRTIDTSLFNVIVVSPRNYFLFTSLL 132 >SPAC25B8.16 |||RNase P and RNase MRP subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 698 Score = 27.5 bits (58), Expect = 2.2 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -2 Query: 85 FGKSNANDIYPVVLTSISSFTEWILQN 5 FG S AN + PV L S SFT +++++ Sbjct: 243 FGNSFANGLPPVFLNSSRSFTSYLVKS 269 >SPAC4D7.13 |usp104|prp40|U1 snRNP-associated protein Usp104|Schizosaccharomyces pombe|chr 1|||Manual Length = 695 Score = 27.1 bits (57), Expect = 2.9 Identities = 18/61 (29%), Positives = 25/61 (40%) Frame = +2 Query: 194 SHDAIMTLVLFPAVFFVGHNEFELVEVAVRYTAALNGSSPSEQINKNTLGYYDTLLDNST 373 S+D I L+ F H+E + +Y L E+ +N GYYD D S Sbjct: 568 SYDEIRPLISILPEFAALHSEEHRMAAFDKYIRRLREKRELEKQYQNRRGYYDVGKDESY 627 Query: 374 L 376 L Sbjct: 628 L 628 >SPBC13G1.14c |||RNA-binding protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 243 Score = 26.6 bits (56), Expect = 3.8 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +1 Query: 103 AHFGRRQGHPSQYCRSRGHQPGPNRRRICYQSRRDH 210 +H+ + H S+Y R+R PG N QS H Sbjct: 202 SHYNDKSFHRSRYSRARSRSPGSNISEYSDQSPPYH 237 >SPCC4G3.18 |||conserved fungal family|Schizosaccharomyces pombe|chr 3|||Manual Length = 828 Score = 26.2 bits (55), Expect = 5.0 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 3/68 (4%) Frame = -3 Query: 621 NSALVLFSPTTTT-FQLLPVSMENSTI--LHTVALSLDLPVAVSPVKYLMFTLLLTIPNS 451 N L+ F T T LLP++ I ++TV LSL + S V+ L+F +L + Sbjct: 290 NLILISFLSTKTDKIVLLPINALKDLIQRVYTVQLSLPVKSVESSVQALLFMVLPHLHTL 349 Query: 450 LRRITTRM 427 + +T ++ Sbjct: 350 VNELTLKL 357 >SPBC13E7.02 |cwf24||GCN5-related N acetyltransferase|Schizosaccharomyces pombe|chr 2|||Manual Length = 533 Score = 26.2 bits (55), Expect = 5.0 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 476 VNIRYFTGLTATGRSSDNATVCRIVEFSME 565 +N+ Y + L+ATG S + TV I E + E Sbjct: 94 INVEYQSNLSATGESVNTTTVSAINEDTRE 123 >SPAC11D3.05 |||membrane transporter|Schizosaccharomyces pombe|chr 1|||Manual Length = 546 Score = 25.8 bits (54), Expect = 6.7 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -1 Query: 587 LPFNCYLFPWRILRSCIPSHYRWIFP 510 LP + + F W +C P H WI P Sbjct: 426 LPISMFWFAW----TCYPHHIHWIVP 447 >SPBC23G7.07c |||replication regulator |Schizosaccharomyces pombe|chr 2|||Manual Length = 277 Score = 25.8 bits (54), Expect = 6.7 Identities = 12/49 (24%), Positives = 22/49 (44%) Frame = -2 Query: 151 DYDNTDLGAPAFFQNALVGIVSFGKSNANDIYPVVLTSISSFTEWILQN 5 D + +L + + +SF K D YP + + FT+ ++QN Sbjct: 102 DLTDVELSDKVIKASYIEDTISFSKPKTVDNYPEYIQHLPGFTKKVVQN 150 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,329,889 Number of Sequences: 5004 Number of extensions: 75118 Number of successful extensions: 240 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 231 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 240 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 361294920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -