BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11k12f (517 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g12430.1 68418.m01461 DNAJ heat shock N-terminal domain-conta... 29 1.9 At5g43630.1 68418.m05333 zinc knuckle (CCHC-type) family protein... 29 2.5 At5g42870.1 68418.m05225 lipin family protein contains Pfam prof... 29 2.5 At1g44120.1 68414.m05096 C2 domain-containing protein / armadill... 28 4.3 At1g35420.1 68414.m04394 dienelactone hydrolase family protein l... 27 5.7 At4g11560.1 68417.m01853 bromo-adjacent homology (BAH) domain-co... 27 7.5 >At5g12430.1 68418.m01461 DNAJ heat shock N-terminal domain-containing protein similarity to TETRATRICOPEPTIDE REPEAT PROTEIN 2 , human, SWISSPROT:TTC2_HUMAN; contains Pfam profiles PF00226: DnaJ domain, PF00515: TPR Domain Length = 1165 Score = 29.1 bits (62), Expect = 1.9 Identities = 19/56 (33%), Positives = 27/56 (48%) Frame = +1 Query: 157 IGELLRAADPLRRDGYAGSWSPPGASDIINFSGRVTDVKADDFSSLHLRRVSYVGT 324 +GE + +D L R GS + G +F G V + K DF+S S+VGT Sbjct: 218 VGEKI-LSDDLSRKLSVGSMTTDGNHSGDSFQGSVNEKKVHDFNSSCPMNYSFVGT 272 >At5g43630.1 68418.m05333 zinc knuckle (CCHC-type) family protein contains Pfam domain PF00098: Zinc knuckle Length = 831 Score = 28.7 bits (61), Expect = 2.5 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = -2 Query: 516 CSSDVTDNDVVCEGDGSGSLSNDVLKGKSSGSERPQDAAEN 394 CS +D+ EG+ L N+ L+ +S+GS+ D A N Sbjct: 142 CSKRSSDSPKAMEGETRDLLVNEQLRMESAGSQEEGDKAHN 182 >At5g42870.1 68418.m05225 lipin family protein contains Pfam profile: PF04571 lipin, N-terminal conserved region Length = 930 Score = 28.7 bits (61), Expect = 2.5 Identities = 21/59 (35%), Positives = 27/59 (45%), Gaps = 1/59 (1%) Frame = -2 Query: 456 SNDVLKGKS-SGSERPQDAAENADFSFSGTD*C*NSGNSQD*VESGADVADTTQMQGAE 283 + D K +S SG Q E FSFS D C GNS G+ +DT ++ G E Sbjct: 374 AGDFEKSQSASGESILQPEIEEEQFSFSDLDECKPGGNS----SVGSSSSDTVKVDGKE 428 >At1g44120.1 68414.m05096 C2 domain-containing protein / armadillo/beta-catenin repeat family protein similar to CCLS 65 [Silene latifolia] GI:2570102; contains Pfam profiles PF00514: Armadillo/beta-catenin-like repeat, PF00168: C2 domain Length = 2114 Score = 27.9 bits (59), Expect = 4.3 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = -2 Query: 516 CSSDVTDNDVVCEGDGSGSLSNDVLKGKSSGSERPQDAAE 397 CSS ++ VV EG+G ++ ++ + KS+ E D+ E Sbjct: 990 CSSHPSNRLVVMEGNGLEIIAENLQRNKSNTQENSSDSEE 1029 >At1g35420.1 68414.m04394 dienelactone hydrolase family protein low similarity to dienelactone hydrolase [Rhodococcus opacus] GI:23094407; contains Pfam profile PF01738: Dienelactone hydrolase family Length = 310 Score = 27.5 bits (58), Expect = 5.7 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +1 Query: 253 GRVTDVKADDFSSLHLRRVSYVGTRLNLVLA 345 GRV DV A D S VS+ GTR++ +A Sbjct: 205 GRVVDVLATDESGYFSTGVSFYGTRIDSAVA 235 >At4g11560.1 68417.m01853 bromo-adjacent homology (BAH) domain-containing protein contains Pfam profile PF01426: BAH domain Length = 587 Score = 27.1 bits (57), Expect = 7.5 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +1 Query: 91 DVDFEPNSQRILDIVISNLFNEIGEL 168 D D+E + QR +D+++ N +G+L Sbjct: 249 DKDYEDSKQREIDVLVKKTMNVLGDL 274 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,795,345 Number of Sequences: 28952 Number of extensions: 181716 Number of successful extensions: 512 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 502 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 512 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -