BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11k09r (738 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 24 1.7 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 2.3 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 23 3.0 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 23 3.0 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 23 4.0 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 23 4.0 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 22 6.9 X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. 22 6.9 EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 prot... 22 6.9 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 22 6.9 AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 prot... 22 6.9 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 21 9.1 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 21 9.1 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 9.1 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 23.8 bits (49), Expect = 1.7 Identities = 11/39 (28%), Positives = 21/39 (53%), Gaps = 5/39 (12%) Frame = -2 Query: 221 FLHTLRLHWVEFMSKFYAGLGYI-----FQPFCFKTILE 120 F++ +R+ +FM + Y LGY+ F PF + + + Sbjct: 217 FMNVMRMKLKQFMPRLYDLLGYVMPDRTFAPFFTRVVTD 255 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 23.4 bits (48), Expect = 2.3 Identities = 9/21 (42%), Positives = 13/21 (61%), Gaps = 1/21 (4%) Frame = +1 Query: 553 CSC-SSMPWLTLPLECSGLGL 612 C C + W T ++CSGLG+ Sbjct: 765 CKCYNDRTWNTNAVDCSGLGV 785 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 23.0 bits (47), Expect = 3.0 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = +3 Query: 600 GLGVVLLSGEQVQRLPEQHDGDAEQRDEHE 689 G+G + +GE V + E D D + D+ + Sbjct: 375 GVGAMNANGEAVGEVDEDDDDDGDDDDDDD 404 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 23.0 bits (47), Expect = 3.0 Identities = 8/28 (28%), Positives = 16/28 (57%) Frame = +2 Query: 155 CSPDRRRICS*IQPSANAEYARMRRVPP 238 C+PD++ ++ S +Y + R+ PP Sbjct: 971 CNPDQKPTEYLLEDSMKQQYGKRRKEPP 998 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 22.6 bits (46), Expect = 4.0 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +1 Query: 181 LMNSTQCKRRVCKNAESPSIMTRMASVNSAQKQNA 285 LM +T+C R +NA + + + A +A QNA Sbjct: 413 LMRNTRCGRYHNQNAGNQNADNQNADNQNANNQNA 447 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 22.6 bits (46), Expect = 4.0 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +1 Query: 607 GLFFLVASRYSGFPSSM 657 G+ F+ RY G PSS+ Sbjct: 78 GMTFVTVPRYKGVPSSL 94 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 21.8 bits (44), Expect = 6.9 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 616 FLVASRYSGFPSSMTGMQSSAMN 684 FL RY+G PSS+ + N Sbjct: 82 FLAVIRYNGVPSSLNVVSDKTGN 104 >X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. Length = 162 Score = 21.8 bits (44), Expect = 6.9 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = +2 Query: 350 IVLRTTQRGRATRPRVGGRRLCERWC*VRIRWC 448 ++L +T G R R+G L ER WC Sbjct: 5 LLLLSTSHGWQIRDRIGDNELEERIIYPGTLWC 37 >EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 21.8 bits (44), Expect = 6.9 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = +2 Query: 350 IVLRTTQRGRATRPRVGGRRLCERWC*VRIRWC 448 ++L +T G R R+G L ER WC Sbjct: 10 LLLLSTSHGWQIRDRIGDNELEERIIYPGTLWC 42 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 21.8 bits (44), Expect = 6.9 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -2 Query: 314 NYVGAIKLYVAFCFWALF 261 +YV AI +Y+ CF +F Sbjct: 299 SYVKAIDIYLVMCFVFVF 316 >AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 21.8 bits (44), Expect = 6.9 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = +2 Query: 350 IVLRTTQRGRATRPRVGGRRLCERWC*VRIRWC 448 ++L +T G R R+G L ER WC Sbjct: 10 LLLLSTSHGWQIRDRIGDNELEERIIYPGTLWC 42 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 21.4 bits (43), Expect = 9.1 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = +1 Query: 418 EMVLSTYSMVWMAWWIMIS 474 E L+ S VW AW ++++ Sbjct: 605 EDALNLSSAVWFAWGVLLN 623 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.4 bits (43), Expect = 9.1 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = -2 Query: 665 IPVMLLGKPLYLLATKKNNPKPEHSNGSVNQGIELQEQ 552 + L GKP+ L + KN ++GSV G + Q Sbjct: 1196 VTAQLAGKPIVLASGNKNVGVGVSNSGSVVLGKQQPSQ 1233 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.4 bits (43), Expect = 9.1 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -2 Query: 632 LLATKKNNPKPEHSNGSVNQ 573 + ATK+ N K NG +NQ Sbjct: 1016 ITATKQLNNKARIGNGPINQ 1035 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 178,375 Number of Sequences: 438 Number of extensions: 3836 Number of successful extensions: 21 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23023035 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -