BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11k06f (593 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 27 0.14 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 27 0.18 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 24 1.3 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 24 1.3 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 3.0 EF127805-1|ABL67942.1| 461|Apis mellifera nicotinic acetylcholi... 21 6.9 EF127804-1|ABL67941.1| 461|Apis mellifera nicotinic acetylcholi... 21 6.9 EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholi... 21 6.9 EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholi... 21 6.9 EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholi... 21 6.9 EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholi... 21 6.9 DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholi... 21 6.9 DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholi... 21 6.9 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 21 6.9 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 21 9.1 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 21 9.1 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 21 9.1 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 21 9.1 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 21 9.1 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 21 9.1 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 21 9.1 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 21 9.1 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 21 9.1 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 21 9.1 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 27.1 bits (57), Expect = 0.14 Identities = 14/54 (25%), Positives = 28/54 (51%) Frame = -2 Query: 520 SNGSNVSNLDRLGDGAIDNNHGLSNDFGFVNDNHGLRDNGIDTGSGDNRGRASL 359 SN S ++ + + + +NN+ +N+ N+N+G DNG G+ +N + Sbjct: 223 SNNSTITAGNANTNASNNNNNNNNNN----NNNNGANDNGNGNGASNNNNNGDM 272 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 26.6 bits (56), Expect = 0.18 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 3/48 (6%) Frame = -2 Query: 511 SNVSNLDRLGDGAIDNNHGLSNDFGF---VNDNHGLRDNGIDTGSGDN 377 S++ D+L D I LS D VN +HG++ +G + GD+ Sbjct: 664 SSIKASDKLKDSRIKTTEKLSTDPNTHFQVNQSHGIKRSGSHSWEGDS 711 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.8 bits (49), Expect = 1.3 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = -2 Query: 472 IDNNHGLSNDFGFVNDNHGLRDNGIDT 392 I NN+ LSN++ + N+N+ +N +T Sbjct: 82 ISNNNSLSNNYNY-NNNYNNYNNNYNT 107 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 23.8 bits (49), Expect = 1.3 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 160 RTCHHR*VRAHFRRTCHCQR 219 R HH AH RRT H R Sbjct: 149 RCLHHDIENAHIRRTLHMNR 168 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.6 bits (46), Expect = 3.0 Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = -3 Query: 207 AGPTEMGSNSSMMA-GPTAIGTKSSMMGAGPATP 109 AG T+ + +++ G T +S G GPATP Sbjct: 208 AGSTDASTPATVTTTGATTTLPAASATGTGPATP 241 Score = 21.0 bits (42), Expect = 9.1 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +2 Query: 293 DNPPLAPVADST 328 D PPL+P +DS+ Sbjct: 439 DQPPLSPQSDSS 450 >EF127805-1|ABL67942.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 6 protein. Length = 461 Score = 21.4 bits (43), Expect = 6.9 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -2 Query: 277 NGDRYELVDDGRPNGDRFEFVDNG 206 +G++ +LV GD +F+ NG Sbjct: 135 DGNQVDLVLSSETGGDLSDFITNG 158 >EF127804-1|ABL67941.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 5 protein. Length = 461 Score = 21.4 bits (43), Expect = 6.9 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -2 Query: 277 NGDRYELVDDGRPNGDRFEFVDNG 206 +G++ +LV GD +F+ NG Sbjct: 135 DGNQVDLVLSSETGGDLSDFITNG 158 >EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 4 protein. Length = 461 Score = 21.4 bits (43), Expect = 6.9 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -2 Query: 277 NGDRYELVDDGRPNGDRFEFVDNG 206 +G++ +LV GD +F+ NG Sbjct: 135 DGNQVDLVLSSETGGDLSDFITNG 158 >EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 3 protein. Length = 461 Score = 21.4 bits (43), Expect = 6.9 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -2 Query: 277 NGDRYELVDDGRPNGDRFEFVDNG 206 +G++ +LV GD +F+ NG Sbjct: 135 DGNQVDLVLSSETGGDLSDFITNG 158 >EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 2 protein. Length = 461 Score = 21.4 bits (43), Expect = 6.9 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -2 Query: 277 NGDRYELVDDGRPNGDRFEFVDNG 206 +G++ +LV GD +F+ NG Sbjct: 135 DGNQVDLVLSSETGGDLSDFITNG 158 >EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 1 protein. Length = 461 Score = 21.4 bits (43), Expect = 6.9 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -2 Query: 277 NGDRYELVDDGRPNGDRFEFVDNG 206 +G++ +LV GD +F+ NG Sbjct: 135 DGNQVDLVLSSETGGDLSDFITNG 158 >DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 21.4 bits (43), Expect = 6.9 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -2 Query: 277 NGDRYELVDDGRPNGDRFEFVDNG 206 +G++ +LV GD +F+ NG Sbjct: 203 DGNQVDLVLSSETGGDLSDFITNG 226 >DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 21.4 bits (43), Expect = 6.9 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -2 Query: 277 NGDRYELVDDGRPNGDRFEFVDNG 206 +G++ +LV GD +F+ NG Sbjct: 203 DGNQVDLVLSSETGGDLSDFITNG 226 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 21.4 bits (43), Expect = 6.9 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -3 Query: 180 SSMMAGPTAIGTKSSMM 130 +S +AG AIGT + MM Sbjct: 275 NSTLAGGVAIGTAAGMM 291 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 9.1 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -2 Query: 472 IDNNHGLSNDFGFVND 425 I NN+ LSN++ + N+ Sbjct: 82 ISNNNSLSNNYNYNNN 97 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 9.1 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -2 Query: 472 IDNNHGLSNDFGFVND 425 I NN+ LSN++ + N+ Sbjct: 82 ISNNNSLSNNYNYNNN 97 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 9.1 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -2 Query: 472 IDNNHGLSNDFGFVND 425 I NN+ LSN++ + N+ Sbjct: 82 ISNNNSLSNNYNYNNN 97 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 9.1 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -2 Query: 472 IDNNHGLSNDFGFVND 425 I NN+ LSN++ + N+ Sbjct: 82 ISNNNSLSNNYNYNNN 97 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 9.1 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -2 Query: 472 IDNNHGLSNDFGFVND 425 I NN+ LSN++ + N+ Sbjct: 82 ISNNNSLSNNYNYNNN 97 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 9.1 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -2 Query: 472 IDNNHGLSNDFGFVND 425 I NN+ LSN++ + N+ Sbjct: 82 ISNNNSLSNNYNYNNN 97 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 9.1 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -2 Query: 472 IDNNHGLSNDFGFVND 425 I NN+ LSN++ + N+ Sbjct: 82 ISNNNSLSNNYNYNNN 97 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 9.1 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -2 Query: 472 IDNNHGLSNDFGFVND 425 I NN+ LSN++ + N+ Sbjct: 82 ISNNNSLSNNYNYNNN 97 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.0 bits (42), Expect = 9.1 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -2 Query: 472 IDNNHGLSNDFGFVND 425 I NN+ LSN++ + N+ Sbjct: 315 ISNNNSLSNNYNYNNN 330 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.0 bits (42), Expect = 9.1 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -2 Query: 472 IDNNHGLSNDFGFVND 425 I NN+ LSN++ + N+ Sbjct: 315 ISNNNSLSNNYNYNNN 330 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 117,542 Number of Sequences: 438 Number of extensions: 3051 Number of successful extensions: 29 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17359926 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -