BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11k04r (624 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC577.06c |||phosphatidylinositol kinase |Schizosaccharomyces ... 27 2.9 SPAC26A3.15c |nsp1||nucleoporin Nsp1|Schizosaccharomyces pombe|c... 26 3.8 SPCC18.09c |||conserved eukaryotic protein|Schizosaccharomyces p... 25 6.7 SPBC609.05 |pob3||FACT complex component Pob3|Schizosaccharomyce... 25 6.7 SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizo... 25 6.7 SPBC31E1.06 |bms1|SPBC800.01|GTP binding protein Bms1|Schizosacc... 25 8.9 >SPBC577.06c |||phosphatidylinositol kinase |Schizosaccharomyces pombe|chr 2|||Manual Length = 1877 Score = 26.6 bits (56), Expect = 2.9 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -1 Query: 336 QPSQWKQQLCWYLGLGCRLRQNFRC 262 QP QW Q+LC L CR ++ C Sbjct: 1785 QPFQWFQELCVKAFLACRPYAHYIC 1809 >SPAC26A3.15c |nsp1||nucleoporin Nsp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 598 Score = 26.2 bits (55), Expect = 3.8 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = -2 Query: 494 TLAFGTANXFSGGTRVTTSSVHMHGSYNMNN 402 T +FG A T +TSS GS N NN Sbjct: 67 TFSFGKAATTGNSTNASTSSPFSFGSTNTNN 97 >SPCC18.09c |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 232 Score = 25.4 bits (53), Expect = 6.7 Identities = 11/37 (29%), Positives = 17/37 (45%) Frame = -2 Query: 434 VHMHGSYNMNNLHNDVAVINHNHVGFNNNIQRINLAS 324 V H +MNNLH + ++H N+ I+ S Sbjct: 135 VGFHAGPSMNNLHLHIMTLDHVSPSLKNSAHYISFTS 171 >SPBC609.05 |pob3||FACT complex component Pob3|Schizosaccharomyces pombe|chr 2|||Manual Length = 512 Score = 25.4 bits (53), Expect = 6.7 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -2 Query: 497 FTLAFGTANXFSGGTRVTTSSVHMHGSYNMNNLHNDVA 384 FTL GT+ FS RV S++ +HND+A Sbjct: 411 FTLRSGTSYQFSNINRVEQSALVAFLESKQIKIHNDLA 448 >SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1224 Score = 25.4 bits (53), Expect = 6.7 Identities = 18/62 (29%), Positives = 29/62 (46%), Gaps = 2/62 (3%) Frame = -3 Query: 286 PASAELPMLXREPTTNKNAKSAF--RSLLTPSAPGLLETL*SLAPPSVLTALTVAAPAGE 113 P +LPM P+ +S F S P+A ++ +L PP ++T +APA Sbjct: 866 PMLGQLPMRRAAPSMAP-VRSPFPGASSAQPAAMSRTSSVSTLPPPPPTASMTASAPAIA 924 Query: 112 TP 107 +P Sbjct: 925 SP 926 >SPBC31E1.06 |bms1|SPBC800.01|GTP binding protein Bms1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1121 Score = 25.0 bits (52), Expect = 8.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 233 VFVGCWLPXQHRKFC 277 VF+ W P Q RKFC Sbjct: 939 VFLRAWYPVQVRKFC 953 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,020,804 Number of Sequences: 5004 Number of extensions: 33247 Number of successful extensions: 90 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 88 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 90 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 275671126 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -