BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11k04r (624 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 27 0.11 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 26 0.26 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 25 0.60 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 25 0.79 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 25 0.79 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 25 0.79 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 25 0.79 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 25 0.79 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 25 0.79 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 25 0.79 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 25 0.79 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 25 0.79 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 25 0.79 DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 24 1.0 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 24 1.0 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 24 1.0 DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 24 1.0 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 24 1.0 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 24 1.0 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 23 1.8 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 23 1.8 DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 22 4.2 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 22 5.6 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 22 5.6 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 21 7.4 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 21 7.4 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 21 7.4 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 27.5 bits (58), Expect = 0.11 Identities = 38/196 (19%), Positives = 78/196 (39%), Gaps = 13/196 (6%) Frame = -2 Query: 581 ICGASLLXNTRSVTAAHCWRSRDAQARQFTLAFGTANXFSGGTRVTTSSVH------MHG 420 ICGA+++ +TAAHC D + + G + +S T + +H +H Sbjct: 187 ICGATIISKRYVLTAAHC--IIDENTTKLAIVVG-EHDWSSKTETNATVLHSINKVIIHP 243 Query: 419 SYNMNNLH----NDVAVI-NHNHVGFNNNIQRINLASGSNNXXXXXXXXXXXGRTSDAXS 255 Y++ ND+A++ + F + + L G + + Sbjct: 244 KYDIIEKDDWQINDIALLKTEKDIKFGDKVGPACLPFQHFLDSFAGSDVTVLGWGHTSFN 303 Query: 254 GANNQQKRQVSLQVITNAVCARTFGNTLIIGSTLCVDGSNGRSTCRXXXXXXXXXXXXXG 75 G + ++ +L ++T C + +GN ++ + +C + G+ C+ Sbjct: 304 GMLSHILQKTTLNMLTQVECYKYYGNIMV--NAMCA-YAKGKDACQMDSGGPVLWQNPRT 360 Query: 74 RQL--IGITSFGSAQG 33 ++L IGI S+G+ G Sbjct: 361 KRLVNIGIISWGAECG 376 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 26.2 bits (55), Expect = 0.26 Identities = 10/33 (30%), Positives = 21/33 (63%) Frame = -2 Query: 449 VTTSSVHMHGSYNMNNLHNDVAVINHNHVGFNN 351 ++ ++H + +YN NN +N+ N+N+ +NN Sbjct: 318 LSNKTIHNNNNYNNNNYNNNYN--NYNNNNYNN 348 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 25.0 bits (52), Expect = 0.60 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = -2 Query: 449 VTTSSVHMHGSYNMNNLHNDVAVINHNHVGFNN 351 ++ ++H + +YN NN +N N+N+ +NN Sbjct: 85 LSNKTIHNNNNYNNNNYNN----YNYNNNNYNN 113 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.6 bits (51), Expect = 0.79 Identities = 11/40 (27%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = -2 Query: 452 RVTTSSVHMHGSYNMNNLHNDVAVINHNHVGFN-NNIQRI 336 ++ +++ + +YN NN +N+ N+N + +N N I++I Sbjct: 80 KIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIEQI 119 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.6 bits (51), Expect = 0.79 Identities = 11/40 (27%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = -2 Query: 452 RVTTSSVHMHGSYNMNNLHNDVAVINHNHVGFN-NNIQRI 336 ++ +++ + +YN NN +N+ N+N + +N N I++I Sbjct: 80 KIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIEQI 119 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.6 bits (51), Expect = 0.79 Identities = 11/40 (27%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = -2 Query: 452 RVTTSSVHMHGSYNMNNLHNDVAVINHNHVGFN-NNIQRI 336 ++ +++ + +YN NN +N+ N+N + +N N I++I Sbjct: 80 KIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIEQI 119 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.6 bits (51), Expect = 0.79 Identities = 11/40 (27%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = -2 Query: 452 RVTTSSVHMHGSYNMNNLHNDVAVINHNHVGFN-NNIQRI 336 ++ +++ + +YN NN +N+ N+N + +N N I++I Sbjct: 80 KIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIEQI 119 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.6 bits (51), Expect = 0.79 Identities = 11/40 (27%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = -2 Query: 452 RVTTSSVHMHGSYNMNNLHNDVAVINHNHVGFN-NNIQRI 336 ++ +++ + +YN NN +N+ N+N + +N N I++I Sbjct: 80 KIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIEQI 119 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.6 bits (51), Expect = 0.79 Identities = 11/40 (27%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = -2 Query: 452 RVTTSSVHMHGSYNMNNLHNDVAVINHNHVGFN-NNIQRI 336 ++ +++ + +YN NN +N+ N+N + +N N I++I Sbjct: 80 KIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIEQI 119 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.6 bits (51), Expect = 0.79 Identities = 11/40 (27%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = -2 Query: 452 RVTTSSVHMHGSYNMNNLHNDVAVINHNHVGFN-NNIQRI 336 ++ +++ + +YN NN +N+ N+N + +N N I++I Sbjct: 80 KIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIEQI 119 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.6 bits (51), Expect = 0.79 Identities = 11/40 (27%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = -2 Query: 452 RVTTSSVHMHGSYNMNNLHNDVAVINHNHVGFN-NNIQRI 336 ++ +++ + +YN NN +N+ N+N + +N N I++I Sbjct: 80 KIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIEQI 119 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 24.6 bits (51), Expect = 0.79 Identities = 11/40 (27%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = -2 Query: 452 RVTTSSVHMHGSYNMNNLHNDVAVINHNHVGFN-NNIQRI 336 ++ +++ + +YN NN +N+ N+N + +N N I++I Sbjct: 313 KIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIEQI 352 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 24.6 bits (51), Expect = 0.79 Identities = 11/40 (27%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = -2 Query: 452 RVTTSSVHMHGSYNMNNLHNDVAVINHNHVGFN-NNIQRI 336 ++ +++ + +YN NN +N+ N+N + +N N I++I Sbjct: 313 KIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIEQI 352 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 24.2 bits (50), Expect = 1.0 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = +2 Query: 227 LGVFVGCWLP 256 +GVFV CWLP Sbjct: 333 MGVFVVCWLP 342 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 24.2 bits (50), Expect = 1.0 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = +2 Query: 227 LGVFVGCWLP 256 +GVFV CWLP Sbjct: 333 MGVFVVCWLP 342 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 1.0 Identities = 11/40 (27%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = -2 Query: 452 RVTTSSVHMHGSYNMNNLHNDVAVINHNHVGFN-NNIQRI 336 ++ +++ + +YN NN +N+ N+N + +N N I++I Sbjct: 80 KIISNNNPLSNNYNYNNNYNNYNKHNYNKLYYNINYIEQI 119 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 24.2 bits (50), Expect = 1.0 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 419 SYNMNNLHNDVAVINHNHVGFNNN 348 S + N +HN+ N+N+ +NNN Sbjct: 83 SLSNNTIHNNNYKYNYNNNNYNNN 106 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 24.2 bits (50), Expect = 1.0 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 419 SYNMNNLHNDVAVINHNHVGFNNN 348 S + N +HN+ N+N+ +NNN Sbjct: 83 SLSNNTIHNNNYKYNYNNNNYNNN 106 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 24.2 bits (50), Expect = 1.0 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = +2 Query: 227 LGVFVGCWLP 256 +GVFV CWLP Sbjct: 333 MGVFVVCWLP 342 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 23.4 bits (48), Expect = 1.8 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = +2 Query: 227 LGVFVGCWLP 256 LGVF+ CWLP Sbjct: 625 LGVFLICWLP 634 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 23.4 bits (48), Expect = 1.8 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = +2 Query: 227 LGVFVGCWLP 256 +GVF+ CWLP Sbjct: 341 MGVFIICWLP 350 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 22.2 bits (45), Expect = 4.2 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +2 Query: 227 LGVFVGCWLP 256 +G FV CWLP Sbjct: 312 VGGFVACWLP 321 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.8 bits (44), Expect = 5.6 Identities = 5/11 (45%), Positives = 8/11 (72%) Frame = -1 Query: 621 CWTCDRTHEWQ 589 CW CD+ E++ Sbjct: 467 CWVCDQCEEYE 477 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.8 bits (44), Expect = 5.6 Identities = 5/11 (45%), Positives = 8/11 (72%) Frame = -1 Query: 621 CWTCDRTHEWQ 589 CW CD+ E++ Sbjct: 557 CWVCDQCEEYE 567 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 21.4 bits (43), Expect = 7.4 Identities = 6/10 (60%), Positives = 9/10 (90%) Frame = +2 Query: 227 LGVFVGCWLP 256 +GVF+ CW+P Sbjct: 278 MGVFLICWVP 287 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 7.4 Identities = 6/19 (31%), Positives = 13/19 (68%) Frame = -2 Query: 449 VTTSSVHMHGSYNMNNLHN 393 ++ ++H + +YN NN +N Sbjct: 85 LSNKTIHNNNNYNNNNYNN 103 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 21.4 bits (43), Expect = 7.4 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 310 LLVLGPGLPASAELP 266 LL GP PA AE+P Sbjct: 97 LLEAGPDEPAGAEIP 111 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 140,286 Number of Sequences: 438 Number of extensions: 2620 Number of successful extensions: 29 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18582456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -