BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11k04r (624 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g13560.1 68417.m02113 late embryogenesis abundant domain-cont... 29 3.3 At1g04310.1 68414.m00422 ethylene receptor-related similar to et... 29 3.3 At1g68050.1 68414.m07774 F-box family protein (FKF1) / adagio 3 ... 28 4.4 At5g23410.1 68418.m02745 expressed protein similar to Adagio 3 [... 28 5.8 >At4g13560.1 68417.m02113 late embryogenesis abundant domain-containing protein / LEA domain-containing protein similar to LEA protein [Cicer arietinum] GI:2909420; contains Pfam profile PF02987: Late embryogenesis abundant protein Length = 109 Score = 28.7 bits (61), Expect = 3.3 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +2 Query: 482 QKRG*TDEPGHPWTSSSEQRSQSGCXSVRKL 574 Q RG E WT S++Q +QS C L Sbjct: 10 QNRGQAQEKAEQWTESAKQTAQSACDKTADL 40 >At1g04310.1 68414.m00422 ethylene receptor-related similar to ethylene receptor CS-ETR2 [Cucumis sativus] GI:6136818; contains Pfam profiles PF01590: GAF domain, PF00512: His Kinase A (phosphoacceptor) domain Length = 645 Score = 28.7 bits (61), Expect = 3.3 Identities = 11/33 (33%), Positives = 21/33 (63%) Frame = +1 Query: 361 PTWLWLMTATSLWRLFML*LPCIWTLEVVTLVP 459 P W W+MTA +++++ + + L +VTL+P Sbjct: 110 PHWPWVMTAVTVFKMLTGIVSFLTALSLVTLLP 142 >At1g68050.1 68414.m07774 F-box family protein (FKF1) / adagio 3 (ADO3) E3 ubiquitin ligase SCF complex F-box subunit; identical to FKF1 GI:6960305 and Adagio 3 GI:13487072 from [Arabidopsis thaliana]; contains Pfam profiles PF01344: Kelch motif, PF00785: PAC motif and PF00646: F-box domain; contains TIGRfam profile TIGR00229: PAS domain S-boxidentical to cDNA Adagio 3 (ADO3) GI:13487071 Length = 619 Score = 28.3 bits (60), Expect = 4.4 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = -2 Query: 527 WRSRDAQARQFTLAFGTANXFSGGTRVTTSSVHMHGSYNMNNLH 396 WR + + LA+G + GGTRV H + +N LH Sbjct: 564 WRILNVPGKPPKLAWGHSTCVVGGTRVLVLGGHTGEEWILNELH 607 >At5g23410.1 68418.m02745 expressed protein similar to Adagio 3 [Arabidopsis thaliana] GI:13487072/FKF1 [Arabidopsis thaliana] GI:6960305 Length = 84 Score = 27.9 bits (59), Expect = 5.8 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = -2 Query: 527 WRSRDAQARQFTLAFGTANXFSGGTRVTTSSVHMHGSYNMNNLH 396 WR + + LA+G + GGTRV H + +N LH Sbjct: 29 WRILNVPGKPPKLAWGHSTCVVGGTRVLVLGGHNGEEWILNELH 72 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,285,441 Number of Sequences: 28952 Number of extensions: 198489 Number of successful extensions: 666 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 639 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 663 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1265787216 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -