SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fmgV11k02r
         (554 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ342040-1|ABC69932.1|  822|Tribolium castaneum STIP protein.          22   4.1  
AY043292-1|AAK96031.1|  323|Tribolium castaneum homeodomain tran...    22   4.1  
AY884062-1|AAX84203.1|  712|Tribolium castaneum laccase 2B protein.    21   5.5  
AY884061-1|AAX84202.1|  717|Tribolium castaneum laccase 2A protein.    21   5.5  
AM292348-1|CAL23160.2|  346|Tribolium castaneum gustatory recept...    21   9.5  

>DQ342040-1|ABC69932.1|  822|Tribolium castaneum STIP protein.
          Length = 822

 Score = 21.8 bits (44), Expect = 4.1
 Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 1/37 (2%)
 Frame = +2

Query: 116 AWIEAVVQIIVIVTGSIDLIIDAAFVPHVDTTLA-WI 223
           AW   +    ++  G++ LI+D  F P    TLA W+
Sbjct: 628 AWYWVMDWSDMLSVGNMTLILDKFFFPRWRQTLAMWL 664


>AY043292-1|AAK96031.1|  323|Tribolium castaneum homeodomain
           transcription factor Prothoraxlessprotein.
          Length = 323

 Score = 21.8 bits (44), Expect = 4.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = +3

Query: 351 QPDPGSC 371
           QPDPGSC
Sbjct: 44  QPDPGSC 50


>AY884062-1|AAX84203.1|  712|Tribolium castaneum laccase 2B protein.
          Length = 712

 Score = 21.4 bits (43), Expect = 5.5
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -1

Query: 491 IFHCHFL 471
           +FHCHFL
Sbjct: 668 LFHCHFL 674


>AY884061-1|AAX84202.1|  717|Tribolium castaneum laccase 2A protein.
          Length = 717

 Score = 21.4 bits (43), Expect = 5.5
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -1

Query: 491 IFHCHFL 471
           +FHCHFL
Sbjct: 668 LFHCHFL 674


>AM292348-1|CAL23160.2|  346|Tribolium castaneum gustatory receptor
           candidate 27 protein.
          Length = 346

 Score = 20.6 bits (41), Expect = 9.5
 Identities = 6/14 (42%), Positives = 9/14 (64%)
 Frame = +1

Query: 259 LRVVVHWHSRHPTY 300
           L+ +  WH  +PTY
Sbjct: 17  LKALTVWHVENPTY 30


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 131,742
Number of Sequences: 336
Number of extensions: 3145
Number of successful extensions: 5
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 122,585
effective HSP length: 53
effective length of database: 104,777
effective search space used: 13725787
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -