BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11k02r (554 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript... 24 3.9 AF364132-1|AAL35508.1| 397|Anopheles gambiae putative odorant r... 23 5.1 >AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase protein. Length = 1209 Score = 23.8 bits (49), Expect = 3.9 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +3 Query: 15 KKLNGRMFSLNRQSFYN 65 +K RMF++N + FYN Sbjct: 384 RKEQNRMFNINEREFYN 400 >AF364132-1|AAL35508.1| 397|Anopheles gambiae putative odorant receptor Or4 protein. Length = 397 Score = 23.4 bits (48), Expect = 5.1 Identities = 11/43 (25%), Positives = 17/43 (39%) Frame = +2 Query: 113 FAWIEAVVQIIVIVTGSIDLIIDAAFVPHVDTTLAWIESTAEV 241 F WI + I S + FV H++ W+E+ V Sbjct: 141 FYWIAPIPSICAHYYRSTNSTEPVRFVQHLEVKFYWLENRTSV 183 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 583,473 Number of Sequences: 2352 Number of extensions: 14041 Number of successful extensions: 23 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 51722361 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -