BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11k02r (554 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 23 2.7 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 22 3.6 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 22.6 bits (46), Expect = 2.7 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = -2 Query: 424 TYGDRRCVNMWDEGCINGQLPGSGWDDYYLNGNFNPG 314 T+ DR+ + M E C+ G+L W G+F+ G Sbjct: 434 TFKDRKYLYMLMEACLGGEL----WTVLRDKGHFDDG 466 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 22.2 bits (45), Expect = 3.6 Identities = 9/17 (52%), Positives = 14/17 (82%), Gaps = 1/17 (5%) Frame = -2 Query: 496 MKYFIVIFCLVSL-VCS 449 M+YFI++ LV+L VC+ Sbjct: 1 MRYFIILLALVALGVCA 17 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,320 Number of Sequences: 438 Number of extensions: 3810 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15949830 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -