BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11k02f (589 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0504 - 8976973-8979414 32 0.39 04_03_0941 - 20950190-20951088,20952436-20952478,20952580-209526... 31 0.68 03_02_0091 + 5574528-5577254 31 0.90 04_03_0380 - 15150814-15152304 30 1.6 04_03_0348 + 14735581-14737071 30 1.6 06_01_0198 + 1529190-1530371 27 8.4 >03_02_0504 - 8976973-8979414 Length = 813 Score = 31.9 bits (69), Expect = 0.39 Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +2 Query: 224 GNFNPGKRCLNMWDDGCANG-QLPGAGNDDY 313 G+F P KRCL W G +G Q+PG +D+ Sbjct: 240 GSFQPAKRCLPPWSLGVLDGEQVPGRVFEDF 270 Score = 27.5 bits (58), Expect = 8.4 Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = +2 Query: 323 GGFNPGKRCVNMWDEGCIN-DQINGAGNDDY 412 G F P KRC+ W G ++ +Q+ G +D+ Sbjct: 240 GSFQPAKRCLPPWSLGVLDGEQVPGRVFEDF 270 >04_03_0941 - 20950190-20951088,20952436-20952478,20952580-20952606, 20953189-20953301,20953872-20954715,20955740-20955790, 20956026-20956126,20956205-20956244,20956360-20957124 Length = 960 Score = 31.1 bits (67), Expect = 0.68 Identities = 20/67 (29%), Positives = 28/67 (41%) Frame = +2 Query: 134 YGDRRCVNMWDEGCINGQLPGSGWDDYYLNGNFNPGKRCLNMWDDGCANGQLPGAGNDDY 313 YG N + + G SG DDY G +N DD ++G +G D+Y Sbjct: 723 YGSTGSYNKSNTDDLTGGFNKSGTDDYSGGGGYNKSGA-----DDYSSSGGYSKSGTDNY 777 Query: 314 YLGGGFN 334 GG+N Sbjct: 778 SGSGGYN 784 >03_02_0091 + 5574528-5577254 Length = 908 Score = 30.7 bits (66), Expect = 0.90 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = +3 Query: 237 PASGALICGMTAVPMDNYPEQATMTITSAVDSIQASVVSTCG 362 P+SGA++ T V M+ Y E+A + +D A VV+ CG Sbjct: 142 PSSGAMVVPSTVVGMEGYLEEA----LACLDDRDAGVVAICG 179 >04_03_0380 - 15150814-15152304 Length = 496 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/79 (24%), Positives = 34/79 (43%), Gaps = 3/79 (3%) Frame = -1 Query: 364 VPHVDTTLAWIESTAEV---IVIVACSG*LSIGTAVIPHIKAPLAGIKVTIQIIVIPTRS 194 +PH+D LA I + A + V C G +S I P A + ++ R Sbjct: 101 LPHLDALLATINADAAAAPPVTCVVCDGVMSFAYDAARRIGVPCAALWTASACGLMGYRH 160 Query: 193 WKLSIDTALIPHVDTAAIS 137 ++ ++ L+P D A ++ Sbjct: 161 YRHLVERGLVPLRDAAQLT 179 >04_03_0348 + 14735581-14737071 Length = 496 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/79 (24%), Positives = 34/79 (43%), Gaps = 3/79 (3%) Frame = -1 Query: 364 VPHVDTTLAWIESTAEV---IVIVACSG*LSIGTAVIPHIKAPLAGIKVTIQIIVIPTRS 194 +PH+D LA I + A + V C G +S I P A + ++ R Sbjct: 101 LPHLDALLATINADAAAAPPVTCVVCDGVMSFAYDAARRIGVPCAALWTASACGLMGYRH 160 Query: 193 WKLSIDTALIPHVDTAAIS 137 ++ ++ L+P D A ++ Sbjct: 161 YRHLVERGLVPLRDAAQLT 179 >06_01_0198 + 1529190-1530371 Length = 393 Score = 27.5 bits (58), Expect = 8.4 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +2 Query: 281 GQLPGAGNDDYYLGGGFNPGKRCVNMWDEGCINDQI 388 G G+GN GGG GK + +DEG + Q+ Sbjct: 63 GAAAGSGNPKQQRGGGGGGGKAAASPFDEGSNSAQL 98 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,331,761 Number of Sequences: 37544 Number of extensions: 372843 Number of successful extensions: 775 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 720 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 772 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1388195172 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -