BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11k02f (589 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 23 2.9 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 22 3.9 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 22.6 bits (46), Expect = 2.9 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +2 Query: 131 TYGDRRCVNMWDEGCINGQLPGSGWDDYYLNGNFNPG 241 T+ DR+ + M E C+ G+L W G+F+ G Sbjct: 434 TFKDRKYLYMLMEACLGGEL----WTVLRDKGHFDDG 466 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 22.2 bits (45), Expect = 3.9 Identities = 9/17 (52%), Positives = 14/17 (82%), Gaps = 1/17 (5%) Frame = +2 Query: 59 MKYFIVIFCLVSL-VCS 106 M+YFI++ LV+L VC+ Sbjct: 1 MRYFIILLALVALGVCA 17 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,553 Number of Sequences: 438 Number of extensions: 3868 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17115420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -