BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11j24r (711 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46598| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 >SB_46598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1910 Score = 29.1 bits (62), Expect = 3.7 Identities = 16/66 (24%), Positives = 30/66 (45%) Frame = +1 Query: 457 VKQYFLRIRILKNKKSXXXXXXXXXXXXKNLSDFASSFDQNKEYAKLIDMVQFFLTRRLL 636 VK YFL++ ++++ ++SD SS + +L D++ F +L Sbjct: 683 VKPYFLKMALMRSLSGFRFSSSRFSRSSSSISDSLSSLRSRASWRRLSDLLDSFC---VL 739 Query: 637 LTDSVH 654 L D V+ Sbjct: 740 LDDPVY 745 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,270,659 Number of Sequences: 59808 Number of extensions: 305626 Number of successful extensions: 639 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 598 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 638 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1877743452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -