BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11j24r (711 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 23 2.2 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 23 2.2 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 23 2.2 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 23.4 bits (48), Expect = 2.2 Identities = 12/38 (31%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +2 Query: 86 K*NNNEITTRFLNKNKQVSCMYYILTS-IYFLFNDNNI 196 K NN +T +FLN+ K+ S + + + + +DN+I Sbjct: 415 KDNNEIVTAQFLNQLKKSSVLVHTKNGRLKYQISDNDI 452 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 23.4 bits (48), Expect = 2.2 Identities = 14/65 (21%), Positives = 27/65 (41%) Frame = +2 Query: 20 NNMDIFTYTIHYLKLYTLDLKIK*NNNEITTRFLNKNKQVSCMYYILTSIYFLFNDNNIQ 199 N I +TI Y + + N+ ++ RF+ N Q S +Y + + + N + Sbjct: 1525 NGCPILYFTIQYRPINEFHWTLVSNSVKMQRRFVVTNLQPSSVYQLKVETHNVAGSNQAE 1584 Query: 200 LIKLT 214 +T Sbjct: 1585 FTFVT 1589 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 23.4 bits (48), Expect = 2.2 Identities = 14/65 (21%), Positives = 27/65 (41%) Frame = +2 Query: 20 NNMDIFTYTIHYLKLYTLDLKIK*NNNEITTRFLNKNKQVSCMYYILTSIYFLFNDNNIQ 199 N I +TI Y + + N+ ++ RF+ N Q S +Y + + + N + Sbjct: 1521 NGCPILYFTIQYRPINEFHWTLVSNSVKMQRRFVVTNLQPSSVYQLKVETHNVAGSNQAE 1580 Query: 200 LIKLT 214 +T Sbjct: 1581 FTFVT 1585 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,967 Number of Sequences: 438 Number of extensions: 3707 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21926700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -