BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11j24f (540 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profi... 29 2.6 At1g67970.1 68414.m07764 heat shock factor protein, putative (HS... 28 4.6 At2g38110.1 68415.m04678 phospholipid/glycerol acyltransferase f... 27 6.1 >At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profile: PF00076 RNA recognition motif Length = 636 Score = 28.7 bits (61), Expect = 2.6 Identities = 20/75 (26%), Positives = 35/75 (46%), Gaps = 9/75 (12%) Frame = +1 Query: 133 ARMESTGPFQPWANDENSKDVKSEAELADDAKLHR---------EDVNHPKHRQTASYNK 285 A++ES+ ++DE + VK + + + AK+ ++ P +QTA K Sbjct: 146 AKVESSSSDDDSSSDEETVPVKKQPAVLEKAKIESSSSDDDSSSDEETVPMKKQTAVLEK 205 Query: 286 ESVSDSTNAPGSSSD 330 S++ GSSSD Sbjct: 206 AKAESSSSDDGSSSD 220 >At1g67970.1 68414.m07764 heat shock factor protein, putative (HSF5) / heat shock transcription factor, putative (HSTF5) identical to heat shock transcription factor 5 (HSF5) SP:Q9S7U5 from [Arabidopsis thaliana]; contains Pfam profile: PF00447 HSF-type DNA-binding domain Length = 374 Score = 27.9 bits (59), Expect = 4.6 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +2 Query: 98 EINKNYFL*LIGLEWKVPVHFSLGQMTKTR 187 E++K+Y L LI E + P F GQ+T R Sbjct: 327 ELDKSYMLKLISEEMEKPDDFEFGQLTPER 356 >At2g38110.1 68415.m04678 phospholipid/glycerol acyltransferase family protein low similarity to SP|O87707 CicA protein {Caulobacter crescentus}; contains Pfam profile PF01553: Acyltransferase Length = 501 Score = 27.5 bits (58), Expect = 6.1 Identities = 23/80 (28%), Positives = 37/80 (46%), Gaps = 1/80 (1%) Frame = -1 Query: 444 YSLSALLTESVLNYLLHRSYFVRVHLGFCTLGSTTGASV-TRGSWSVS*ITDTFFIVRRS 268 Y L AL S+L L+ V+L + T+ T +V +++ I D +VR Sbjct: 44 YFLVALEAGSLLRALILLVSVPFVYLTYLTISETLAINVFVFITFAGLKIRDVELVVRSV 103 Query: 267 LPMFWMIDIFPMKFRVIR*F 208 LP F+ D+ P +R+ F Sbjct: 104 LPRFYAEDVRPDTWRIFNTF 123 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,836,858 Number of Sequences: 28952 Number of extensions: 203496 Number of successful extensions: 488 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 486 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 488 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1003808112 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -