BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fmgV11j23r
(752 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AK128416-1|BAC87430.1| 303|Homo sapiens protein ( Homo sapiens ... 30 7.8
>AK128416-1|BAC87430.1| 303|Homo sapiens protein ( Homo sapiens
cDNA FLJ46559 fis, clone THYMU3040126. ).
Length = 303
Score = 30.3 bits (65), Expect = 7.8
Identities = 17/62 (27%), Positives = 30/62 (48%), Gaps = 7/62 (11%)
Frame = +3
Query: 282 TREFAVDY**LCYHFKNRRRVY*CSAVFFFIYVHRFLRPY-YTFLVVMW------SHCSV 440
TR + Y +C H +VY C +I+ H + Y YT++ +W +HC++
Sbjct: 231 TRIYTYTYVCVCTHAYIHTQVYVCVCTHAYIHTHVCVCVYTYTYMYTLWCRGTIIAHCTL 290
Query: 441 QL 446
+L
Sbjct: 291 EL 292
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 100,990,220
Number of Sequences: 237096
Number of extensions: 2110683
Number of successful extensions: 2556
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2473
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2554
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 9071127468
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -