BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11j23r (752 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014134-1416|ABI31300.1| 2682|Drosophila melanogaster CG8486-PC... 30 3.9 AE014134-1415|AAN11153.1| 2720|Drosophila melanogaster CG8486-PB... 30 3.9 AE014134-1414|AAF52611.1| 2771|Drosophila melanogaster CG8486-PA... 30 3.9 >AE014134-1416|ABI31300.1| 2682|Drosophila melanogaster CG8486-PC, isoform C protein. Length = 2682 Score = 29.9 bits (64), Expect = 3.9 Identities = 14/48 (29%), Positives = 26/48 (54%) Frame = +3 Query: 444 LVYSLKWVFNSIIYFYPTNIITRKFLRMYGCLFVTLSSKATEWILMQL 587 +++ KW ++ F NI+ + +M GCLF+T +K W++ L Sbjct: 1270 IIFRWKW----LLAFNVANILIKTSFQMAGCLFMTQLTKDCCWLVHML 1313 >AE014134-1415|AAN11153.1| 2720|Drosophila melanogaster CG8486-PB, isoform B protein. Length = 2720 Score = 29.9 bits (64), Expect = 3.9 Identities = 14/48 (29%), Positives = 26/48 (54%) Frame = +3 Query: 444 LVYSLKWVFNSIIYFYPTNIITRKFLRMYGCLFVTLSSKATEWILMQL 587 +++ KW ++ F NI+ + +M GCLF+T +K W++ L Sbjct: 1270 IIFRWKW----LLAFNVANILIKTSFQMAGCLFMTQLTKDCCWLVHML 1313 >AE014134-1414|AAF52611.1| 2771|Drosophila melanogaster CG8486-PA, isoform A protein. Length = 2771 Score = 29.9 bits (64), Expect = 3.9 Identities = 14/48 (29%), Positives = 26/48 (54%) Frame = +3 Query: 444 LVYSLKWVFNSIIYFYPTNIITRKFLRMYGCLFVTLSSKATEWILMQL 587 +++ KW ++ F NI+ + +M GCLF+T +K W++ L Sbjct: 1270 IIFRWKW----LLAFNVANILIKTSFQMAGCLFMTQLTKDCCWLVHML 1313 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,823,584 Number of Sequences: 53049 Number of extensions: 625069 Number of successful extensions: 1226 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1210 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1226 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3437745267 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -