BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11j23r (752 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 23 4.1 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 22 5.4 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 22 5.4 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 22 5.4 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 22 7.1 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 21 9.4 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 22.6 bits (46), Expect = 4.1 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +3 Query: 438 VQLVYSLKWVFNSIIY 485 V++V +KW + SIIY Sbjct: 272 VEIVMKMKWSYVSIIY 287 Score = 21.4 bits (43), Expect = 9.4 Identities = 9/31 (29%), Positives = 15/31 (48%) Frame = +2 Query: 356 GCVFFYIRTQISQALLHLFGCNVVPLFSSIG 448 GC+ F +++ + + CN FS IG Sbjct: 344 GCIIFGSDQEVAGVMRAVKRCNATGAFSWIG 374 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 22.2 bits (45), Expect = 5.4 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +3 Query: 12 YNKTYNSNIAYLYK 53 YN YN+N LYK Sbjct: 105 YNNNYNNNYKKLYK 118 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 22.2 bits (45), Expect = 5.4 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +3 Query: 12 YNKTYNSNIAYLYK 53 YN YN+N LYK Sbjct: 105 YNNNYNNNYKKLYK 118 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 22.2 bits (45), Expect = 5.4 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +2 Query: 650 NYPKYNDKCQVSRKKIWFPIQY 715 NY YN+ + KK+++ I Y Sbjct: 336 NYNNYNNNYNNNYKKLYYNINY 357 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 21.8 bits (44), Expect = 7.1 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +2 Query: 650 NYPKYNDKCQVSRKKIWFPIQY 715 NY YN+ KK+++ I Y Sbjct: 93 NYNNYNNNYNNYNKKLYYNINY 114 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +1 Query: 34 TLRIYINAVLFLRSSVLNYT 93 TLR+Y A + +R ++ +YT Sbjct: 363 TLRMYPPASILMRKAISDYT 382 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 214,613 Number of Sequences: 438 Number of extensions: 5025 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23632110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -