BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11j23f (584 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. 23 1.4 EU019713-1|ABU25225.1| 528|Tribolium castaneum chitin deacetyla... 22 3.3 EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetyla... 21 5.8 EF222298-1|ABN79658.1| 120|Tribolium castaneum ion transport pe... 21 5.8 DQ138190-1|ABA03054.1| 135|Tribolium castaneum bursicon-like pr... 21 5.8 >DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. Length = 314 Score = 23.4 bits (48), Expect = 1.4 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 213 RTINLSCQPCI*FVHLLRY 157 R NL+CQP + +V RY Sbjct: 240 RKENLTCQPAVPYVPFYRY 258 >EU019713-1|ABU25225.1| 528|Tribolium castaneum chitin deacetylase 2B protein. Length = 528 Score = 22.2 bits (45), Expect = 3.3 Identities = 8/33 (24%), Positives = 18/33 (54%) Frame = +2 Query: 329 FDVSVSDCVWYLRASNPEEKQQWIDILESFKVE 427 FD+ C W + +N ++ ++ +L +FK + Sbjct: 73 FDIDKQTCDWKGKVNNCDKLEKPRKVLPNFKTD 105 >EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetylase 2A protein. Length = 535 Score = 21.4 bits (43), Expect = 5.8 Identities = 8/33 (24%), Positives = 17/33 (51%) Frame = +2 Query: 329 FDVSVSDCVWYLRASNPEEKQQWIDILESFKVE 427 FD+ C W + +N + ++ +L +FK + Sbjct: 80 FDIERQTCDWKTKVNNCDVIEKPRKVLPNFKTD 112 >EF222298-1|ABN79658.1| 120|Tribolium castaneum ion transport peptide isoform B protein. Length = 120 Score = 21.4 bits (43), Expect = 5.8 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -1 Query: 101 CFRQSYCVTCMEVLTLNQ 48 CF Y V C+E L L++ Sbjct: 89 CFSTKYFVGCVESLLLSE 106 >DQ138190-1|ABA03054.1| 135|Tribolium castaneum bursicon-like protein protein. Length = 135 Score = 21.4 bits (43), Expect = 5.8 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -3 Query: 102 MFSSIILCYVYGS 64 MF IILC VY + Sbjct: 1 MFDKIILCLVYAT 13 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 124,976 Number of Sequences: 336 Number of extensions: 2320 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14621740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -