BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11j23f (584 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0359 + 3152483-3152857,3154493-3154855,3155133-3155211,315... 41 6e-04 03_05_0843 + 28126480-28127007,28127092-28127457,28129388-281294... 41 6e-04 01_06_1395 + 37010446-37010895 40 0.001 12_01_1055 - 10861665-10861829,10862827-10863171,10864374-108646... 39 0.003 05_05_0038 - 21769936-21770199,21770785-21771198,21771274-217714... 37 0.010 07_01_0700 + 5280650-5281757,5282509-5282519,5282872-5282967 32 0.29 10_08_0877 + 21230447-21230815,21231855-21232208,21232417-212325... 32 0.39 06_01_0989 + 7672764-7672904,7673017-7673067,7673176-7673296,767... 29 3.6 05_01_0066 - 465526-466107,466541-466741 29 3.6 02_05_1156 - 34528204-34529411,34529982-34530122,34530214-34531072 28 4.8 06_03_0576 - 22443668-22444146,22446239-22446393,22447251-224473... 28 6.3 11_06_0696 + 26358713-26359779,26359826-26360110,26360177-263603... 27 8.3 >08_01_0359 + 3152483-3152857,3154493-3154855,3155133-3155211, 3155473-3155879,3156342-3156497,3156728-3156895, 3156991-3157131,3157739-3157966,3158063-3158176, 3158293-3158448 Length = 728 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/36 (47%), Positives = 21/36 (58%) Frame = +2 Query: 134 GGTPELRGYLSKWTNYIHGWQDRFIVLKDSTLSYYK 241 G + G L KWTNY GW++R+ L D LSY K Sbjct: 43 GAAVAVAGVLHKWTNYGRGWRERWFSLHDGVLSYSK 78 Score = 29.9 bits (64), Expect = 1.6 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +2 Query: 272 GALCLKKAKVKPHEFDDCRFDVSVSDCVWYLRASNPEEKQQWIDIL 409 G +CLK + + + DD RF + +L+ + E++ WI+ L Sbjct: 120 GVVCLKLSAFRESKSDDRRFYIFSPTKTLHLKTDSKEDRVAWIEAL 165 >03_05_0843 + 28126480-28127007,28127092-28127457,28129388-28129487, 28130266-28130546,28130643-28130705,28131276-28131431, 28131913-28132080,28132158-28132298,28132714-28132840, 28132888-28132994,28134142-28134372,28134446-28134559, 28135091-28135261 Length = 850 Score = 41.1 bits (92), Expect = 6e-04 Identities = 16/31 (51%), Positives = 19/31 (61%) Frame = +2 Query: 149 LRGYLSKWTNYIHGWQDRFIVLKDSTLSYYK 241 + G L KW NY GW+ R+ L D LSYYK Sbjct: 89 ISGILYKWVNYGRGWRPRWFALHDGVLSYYK 119 Score = 31.9 bits (69), Expect = 0.39 Identities = 15/50 (30%), Positives = 26/50 (52%) Frame = +2 Query: 272 GALCLKKAKVKPHEFDDCRFDVSVSDCVWYLRASNPEEKQQWIDILESFK 421 G + LK + V+ DD RF + +LRA E++ W++ L++ K Sbjct: 171 GEIHLKVSSVRESRSDDRRFSIFSGTKRLHLRAETREDRAAWVEALQATK 220 >01_06_1395 + 37010446-37010895 Length = 149 Score = 40.3 bits (90), Expect = 0.001 Identities = 27/93 (29%), Positives = 44/93 (47%), Gaps = 5/93 (5%) Frame = +2 Query: 140 TPELRGYLSKWTNYIHGWQDRFIVLKDSTLSYYKNELESNLGC-RG----ALCLKKAKVK 304 +PE G+L+K YI W+ R+ VLK L ++K+ + RG A CL + Sbjct: 21 SPERAGWLTKQGEYIKTWRRRWFVLKQGRLFWFKDSGVTRASVPRGVIPVATCLTVKGAE 80 Query: 305 PHEFDDCRFDVSVSDCVWYLRASNPEEKQQWID 403 F++S Y A + +EK++WI+ Sbjct: 81 DTLNRQFAFELSTPAETMYFIADSEKEKEEWIN 113 >12_01_1055 - 10861665-10861829,10862827-10863171,10864374-10864682, 10864813-10864968,10865669-10866117,10869275-10869359, 10869944-10870300,10870672-10871076 Length = 756 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +2 Query: 155 GYLSKWTNYIHGWQDRFIVLKDSTLSYYK 241 G L KW NY GW+ R+ VL+ LSYYK Sbjct: 58 GVLHKWVNYGKGWRLRWFVLEGGVLSYYK 86 >05_05_0038 - 21769936-21770199,21770785-21771198,21771274-21771434, 21771544-21771607,21771682-21771864,21772355-21772520, 21773397-21773528,21775085-21775599 Length = 632 Score = 37.1 bits (82), Expect = 0.010 Identities = 26/91 (28%), Positives = 42/91 (46%), Gaps = 5/91 (5%) Frame = +2 Query: 146 ELRGYLSKWTNYIHGWQDRFIVLKDSTLSYYKNELESNLGC-RG----ALCLKKAKVKPH 310 E G+L+K YI W+ R+ VLK L ++K+ + RG A CL + Sbjct: 39 ERTGWLNKQGEYIKTWRRRWFVLKQGRLFWFKDAAVTRGSVPRGVIPVATCLTVKGAEDV 98 Query: 311 EFDDCRFDVSVSDCVWYLRASNPEEKQQWID 403 F++S Y A + +EK++WI+ Sbjct: 99 INRQFAFELSTPTDTMYFIADSEKEKEEWIN 129 >07_01_0700 + 5280650-5281757,5282509-5282519,5282872-5282967 Length = 404 Score = 32.3 bits (70), Expect = 0.29 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 2/60 (3%) Frame = +2 Query: 110 SDSSDLEEGGTPELRGYLSKWTNYIHGWQDRFIVLKDSTLSYY--KNELESNLGCRGALC 283 SD S LE G P KW+ + G +R + + TLSY+ N+L + G +G LC Sbjct: 221 SDPSFLERGCMPSFDFATEKWSVALQGPLNRILEESNGTLSYHDLANQLMLS-GLKGTLC 279 >10_08_0877 + 21230447-21230815,21231855-21232208,21232417-21232504, 21232844-21233268,21233477-21233632,21233849-21234016, 21234170-21234310,21234393-21234629,21234710-21234823, 21235096-21235272 Length = 742 Score = 31.9 bits (69), Expect = 0.39 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +2 Query: 155 GYLSKWTNYIHGWQDRFIVLKDSTLSYYK 241 G L KWTN GW+ R+ ++ L+Y K Sbjct: 52 GVLYKWTNIGKGWRPRWFAIRGGVLAYSK 80 >06_01_0989 + 7672764-7672904,7673017-7673067,7673176-7673296, 7673406-7673510,7673963-7674024,7674398-7674515, 7674596-7674932,7675389-7675536,7675632-7675733, 7675824-7675943,7676436-7676519,7676622-7676749, 7677351-7677435,7677566-7677713,7677971-7678047, 7678187-7678243,7678423-7678561,7678642-7678796, 7679003-7679116,7679208-7679275,7679830-7679996, 7680245-7680453 Length = 911 Score = 28.7 bits (61), Expect = 3.6 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 2/58 (3%) Frame = +2 Query: 155 GYLSKWTNYIHGWQDRFIVL--KDSTLSYYKNELESNLGCRGALCLKKAKVKPHEFDD 322 GYL K + +GW R+ VL K L Y K + E + RG + L++ ++ E ++ Sbjct: 584 GYLLKKSAKTNGWSRRWFVLNEKSGKLGYTKKQEERHF--RGVITLEECNLEEVEEEE 639 >05_01_0066 - 465526-466107,466541-466741 Length = 260 Score = 28.7 bits (61), Expect = 3.6 Identities = 16/56 (28%), Positives = 30/56 (53%) Frame = +3 Query: 366 ERLIQRRNSNGLIF*SLSKLNQGTVQVQIVAQMEEVFKGMVLPLHYSLQGHTVTLH 533 E L R + L+F + K +GTV+++I++ +VF G + ++ H V L+ Sbjct: 126 ETLESRLSEVELVFNCVKKALEGTVEIKILSD-AQVFHGKITACTTNVPNHAVLLY 180 >02_05_1156 - 34528204-34529411,34529982-34530122,34530214-34531072 Length = 735 Score = 28.3 bits (60), Expect = 4.8 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 2/55 (3%) Frame = +3 Query: 339 LLATAFGT*--ERLIQRRNSNGLIF*SLSKLNQGTVQVQIVAQMEEVFKGMVLPL 497 LLA AFG R I+ R +N ++ K N+G + Q+V+Q ++ + M++PL Sbjct: 347 LLAMAFGAVFLTRKIKNRRAN-MLRQMFFKQNRGHLLQQLVSQNTDIAERMIIPL 400 >06_03_0576 - 22443668-22444146,22446239-22446393,22447251-22447331, 22448475-22448618,22449670-22449695,22449748-22449811, 22449905-22449996,22450550-22450780,22451238-22451678, 22451754-22452293 Length = 750 Score = 27.9 bits (59), Expect = 6.3 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 3/45 (6%) Frame = +2 Query: 299 VKPHEFDD---CRFDVSVSDCVWYLRASNPEEKQQWIDILESFKV 424 +KPH D CRF D V +LR+ PE +Q I L+ F V Sbjct: 67 LKPHPARDRDLCRFHAD--DYVAFLRSVTPETQQDQIRALKRFNV 109 >11_06_0696 + 26358713-26359779,26359826-26360110,26360177-26360356, 26360516-26360585,26361051-26361950 Length = 833 Score = 27.5 bits (58), Expect = 8.3 Identities = 22/58 (37%), Positives = 32/58 (55%) Frame = -3 Query: 174 VHLLRYPRSSGVPPSSKSELSLTVMFSSIILCYVYGSVNIKSTLNKMTPNNEKPNFYL 1 V L YP SS ++ S LSL+ FS+I + + +V I+S LNK N K + +L Sbjct: 88 VLLPNYPMSSSRKSTACSGLSLSSCFSNIRIRHEV-AVKIRS-LNKKIDNISKDDVFL 143 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,348,566 Number of Sequences: 37544 Number of extensions: 230406 Number of successful extensions: 637 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 627 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 635 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1376330256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -