BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11j18r (719 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g43630.1 68418.m05333 zinc knuckle (CCHC-type) family protein... 30 1.3 At1g55830.1 68414.m06402 expressed protein similar to M-type 9 p... 29 2.3 At5g42870.1 68418.m05225 lipin family protein contains Pfam prof... 29 3.1 At5g12430.1 68418.m01461 DNAJ heat shock N-terminal domain-conta... 29 3.1 At3g13410.1 68416.m01686 expressed protein 29 3.1 At2g01130.1 68415.m00021 helicase domain-containing protein simi... 29 3.1 At4g01960.1 68417.m00261 expressed protein 28 5.4 At2g45680.1 68415.m05680 TCP family transcription factor, putati... 28 7.2 At2g43810.1 68415.m05446 small nuclear ribonucleoprotein F, puta... 28 7.2 At1g44120.1 68414.m05096 C2 domain-containing protein / armadill... 28 7.2 At5g15130.1 68418.m01773 WRKY family transcription factor contai... 27 9.5 At1g36730.1 68414.m04569 eukaryotic translation initiation facto... 27 9.5 At1g35420.1 68414.m04394 dienelactone hydrolase family protein l... 27 9.5 >At5g43630.1 68418.m05333 zinc knuckle (CCHC-type) family protein contains Pfam domain PF00098: Zinc knuckle Length = 831 Score = 30.3 bits (65), Expect = 1.3 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 2/57 (3%) Frame = +3 Query: 162 EIDLEVRFDIANSY--CSSDVTDNDVVCEGDGSGSLSNDVLKGKSSGSERPQDAAEN 326 E +E DI N CS +D+ EG+ L N+ L+ +S+GS+ D A N Sbjct: 126 EDKVETNDDIKNEEAGCSKRSSDSPKAMEGETRDLLVNEQLRMESAGSQEEGDKAHN 182 >At1g55830.1 68414.m06402 expressed protein similar to M-type 9 protein (GI:507127) [Streptococcus pyogenes] Length = 509 Score = 29.5 bits (63), Expect = 2.3 Identities = 24/91 (26%), Positives = 41/91 (45%), Gaps = 1/91 (1%) Frame = +1 Query: 124 RKLLTAGP-TSRPKRLIWRLDLTSPIVIAAPMSLTMMLSARETEAVASATTFSRASPPEA 300 RK LTAG SRPK +R D++ +++ T + ++ EAV T + + Sbjct: 130 RKTLTAGDIASRPKMETFR-DISDDMMVNEDKDETFDMHIQKVEAVLKDLTMTSEKSHSS 188 Query: 301 KDLRTRLKMRISPSAEPTDAETLGTARTKLS 393 L + S++ TD + + R+ LS Sbjct: 189 DSLAKNTSANVDFSSQKTD-DPVTDVRSDLS 218 >At5g42870.1 68418.m05225 lipin family protein contains Pfam profile: PF04571 lipin, N-terminal conserved region Length = 930 Score = 29.1 bits (62), Expect = 3.1 Identities = 24/80 (30%), Positives = 32/80 (40%) Frame = +3 Query: 198 SYCSSDVTDNDVVCEGDGSGSLSNDVLKGKSSGSERPQDAAENADFSFSGTD*C*NSGNS 377 S S V D + + D S + +SG Q E FSFS D C GNS Sbjct: 353 SSTGSPVQDENKITIKDMHISAGDFEKSQSASGESILQPEIEEEQFSFSDLDECKPGGNS 412 Query: 378 QD*VESGADVADTTQMQGAE 437 G+ +DT ++ G E Sbjct: 413 ----SVGSSSSDTVKVDGKE 428 >At5g12430.1 68418.m01461 DNAJ heat shock N-terminal domain-containing protein similarity to TETRATRICOPEPTIDE REPEAT PROTEIN 2 , human, SWISSPROT:TTC2_HUMAN; contains Pfam profiles PF00226: DnaJ domain, PF00515: TPR Domain Length = 1165 Score = 29.1 bits (62), Expect = 3.1 Identities = 19/56 (33%), Positives = 27/56 (48%) Frame = -1 Query: 563 IGELLRAADPLRRDGYAGSWSPPGASDIINFSGRVTDVKADDFSSLHLRRVSYVGT 396 +GE + +D L R GS + G +F G V + K DF+S S+VGT Sbjct: 218 VGEKI-LSDDLSRKLSVGSMTTDGNHSGDSFQGSVNEKKVHDFNSSCPMNYSFVGT 272 >At3g13410.1 68416.m01686 expressed protein Length = 321 Score = 29.1 bits (62), Expect = 3.1 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = +3 Query: 138 GWSNFASEEIDLEVRFDIANSYCSSDVTDNDVVCEGDGSGSLSN 269 GWSNF E LE D+A + ++ +DV + + +L N Sbjct: 70 GWSNFLCSEKKLEQPVDVALVFIGRELLSSDVSSKRNSDPALVN 113 >At2g01130.1 68415.m00021 helicase domain-containing protein similar to DEIH-box RNA/DNA helicase [Arabidopsis thaliana] GI:5881579; contains Pfam profiles PF04408: Helicase associated domain (HA2), PF00271: Helicase conserved C-terminal domain Length = 1112 Score = 29.1 bits (62), Expect = 3.1 Identities = 12/41 (29%), Positives = 24/41 (58%) Frame = -1 Query: 131 NFLEKIPVYLTDYAAEVSRVLEYVAQLVINRLL*ITRTDTW 9 + L+++ YLT+Y ++ S ++ V ++R I+ TD W Sbjct: 135 DLLQRVEAYLTEYLSKSSNRIDRVPANSVSRTSSISSTDEW 175 >At4g01960.1 68417.m00261 expressed protein Length = 236 Score = 28.3 bits (60), Expect = 5.4 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 2/56 (3%) Frame = +3 Query: 153 ASEEIDLEVRFDIANSYCSSDVTDNDVVCEGDGSGSLSNDVLKGKSS--GSERPQD 314 + EE DL+V + + ++T N V EGD S ++ N V G+ S GSE+ D Sbjct: 6 SGEEEDLDVDIEDGRFNETQEITTNLVSAEGD-SENVLNHVWSGRLSFDGSEKSAD 60 >At2g45680.1 68415.m05680 TCP family transcription factor, putative similar to PCF2 (GI:2580440) [Oryza sativa] Length = 356 Score = 27.9 bits (59), Expect = 7.2 Identities = 25/110 (22%), Positives = 46/110 (41%) Frame = +1 Query: 142 GPTSRPKRLIWRLDLTSPIVIAAPMSLTMMLSARETEAVASATTFSRASPPEAKDLRTRL 321 G S + + W L+ P +IAA + T+ A T + A ++L + Sbjct: 107 GHKSDGETIRWLLENAEPAIIAATGTGTVPAIAMSVNGTLKIPTTTNADSDMGENLMKKK 166 Query: 322 KMRISPSAEPTDAETLGTARTKLSRVPT*LTRRKCRELKSSALTSVTRPE 471 + R S ++E D +A + L+ + T T + + L SS + P+ Sbjct: 167 RKRPS-NSEYIDISDAVSASSGLAPIATTTTIQPPQALASSTVAQQLLPQ 215 >At2g43810.1 68415.m05446 small nuclear ribonucleoprotein F, putative / U6 snRNA-associated Sm-like protein, putative / Sm protein F, putative similar to SWISS-PROT:Q9Y4Y8 U6 snRNA-associated Sm-like protein LSm6 [Mus musculus] Length = 91 Score = 27.9 bits (59), Expect = 7.2 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = +3 Query: 132 VDGWSNFASEEIDLEVRFDIANSYCSSDVTDNDVVCEGDGSGSLSN 269 +DG+ N A E+ + V + N+Y + V N+V+ G+LS+ Sbjct: 44 LDGYMNIAMEQTEEYVNGQLKNTYGDAFVRGNNVLYISTTKGTLSD 89 >At1g44120.1 68414.m05096 C2 domain-containing protein / armadillo/beta-catenin repeat family protein similar to CCLS 65 [Silene latifolia] GI:2570102; contains Pfam profiles PF00514: Armadillo/beta-catenin-like repeat, PF00168: C2 domain Length = 2114 Score = 27.9 bits (59), Expect = 7.2 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = +3 Query: 204 CSSDVTDNDVVCEGDGSGSLSNDVLKGKSSGSERPQDAAE 323 CSS ++ VV EG+G ++ ++ + KS+ E D+ E Sbjct: 990 CSSHPSNRLVVMEGNGLEIIAENLQRNKSNTQENSSDSEE 1029 >At5g15130.1 68418.m01773 WRKY family transcription factor contains Pfam profile: PF03106 WRKY DNA -binding domain; TMV response-related gene product, Nicotiana tabacum, EMBL:AB024510 Length = 548 Score = 27.5 bits (58), Expect = 9.5 Identities = 13/53 (24%), Positives = 28/53 (52%) Frame = +3 Query: 180 RFDIANSYCSSDVTDNDVVCEGDGSGSLSNDVLKGKSSGSERPQDAAENADFS 338 R I+N+ ++ T+N+ C G S L ++++ +G+ Q +++ FS Sbjct: 475 RHSISNNIQQTNTTNNNKGCGGYFSSLLMSNIMASNQTGASLDQPSSQLPPFS 527 >At1g36730.1 68414.m04569 eukaryotic translation initiation factor 5, putative / eIF-5, putative similar to SP|P55876 Eukaryotic translation initiation factor 5 (eIF-5) {Zea mays}; contains Pfam profiles PF02020: eIF4-gamma/eIF5/eIF2-epsilon, PF01873: Domain found in IF2B/IF5 Length = 439 Score = 27.5 bits (58), Expect = 9.5 Identities = 20/60 (33%), Positives = 27/60 (45%) Frame = +3 Query: 153 ASEEIDLEVRFDIANSYCSSDVTDNDVVCEGDGSGSLSNDVLKGKSSGSERPQDAAENAD 332 AS E EV I Y D+ D DV+ E G S+ VLK + E Q+A ++ Sbjct: 379 ASAEAAKEVALVIKGLY-DEDILDEDVIVEWYNKGVKSSPVLKNVTPFIEWLQNAESESE 437 >At1g35420.1 68414.m04394 dienelactone hydrolase family protein low similarity to dienelactone hydrolase [Rhodococcus opacus] GI:23094407; contains Pfam profile PF01738: Dienelactone hydrolase family Length = 310 Score = 27.5 bits (58), Expect = 9.5 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = -1 Query: 467 GRVTDVKADDFSSLHLRRVSYVGTRLNLVLA 375 GRV DV A D S VS+ GTR++ +A Sbjct: 205 GRVVDVLATDESGYFSTGVSFYGTRIDSAVA 235 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,056,132 Number of Sequences: 28952 Number of extensions: 273172 Number of successful extensions: 834 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 815 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 834 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1565336320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -