BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11j17r (303 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0496 + 3939731-3939758,3940459-3942773 32 0.099 05_01_0490 + 4083768-4083775,4083845-4084336,4084441-4084522,408... 29 0.53 06_02_0008 - 10552066-10552116,10552224-10552323,10552394-105524... 27 2.1 05_05_0051 + 21923402-21923763,21923861-21923951,21924048-219241... 27 2.1 01_06_1440 + 37378121-37378958,37379344-37379494,37379567-373799... 27 2.8 06_03_0548 + 22004338-22006746 27 3.7 06_01_1044 - 8208126-8208230,8208468-8208536,8208640-8208711 27 3.7 05_01_0290 + 2270749-2271037,2272227-2272363,2272660-2272805,227... 27 3.7 02_04_0349 + 22222091-22222639,22222718-22223695 27 3.7 01_06_1681 - 39129620-39130120 27 3.7 01_06_1588 + 38474698-38477169 27 3.7 05_03_0317 - 12249228-12249275,12263876-12264518,12264954-122666... 26 4.9 01_07_0075 + 40908875-40909069,40909147-40909215,40909363-409094... 26 4.9 01_01_0824 + 6411899-6411931,6412001-6412210,6412302-6412451,641... 26 4.9 02_05_0788 + 31758119-31758384,31758482-31758634,31759385-317595... 26 6.5 01_01_0156 - 1364856-1365401 26 6.5 01_01_0027 - 205450-206029,206706-207276,207408-207836,208438-20... 26 6.5 09_06_0371 + 22615809-22617431,22618312-22618422,22619361-226194... 25 8.6 05_07_0226 - 28515052-28515064,28515426-28515502,28515610-285157... 25 8.6 04_01_0453 + 5869627-5870232,5870383-5870897,5870964-5871600 25 8.6 03_06_0402 + 33681451-33681706,33682800-33682936,33683103-336831... 25 8.6 >12_01_0496 + 3939731-3939758,3940459-3942773 Length = 780 Score = 31.9 bits (69), Expect = 0.099 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +3 Query: 78 WQV*MRAPT-QAVLVRYGSSQVLTQGSSVQWAFSGHPYSVVLASRAITATIR 230 WQ+ A +A L+ G+ V QG S+ W HP + +L + +TAT + Sbjct: 101 WQISSSAEAVRAELMDSGNLVVKDQGGSILWQSFDHPTNTLLPMQPVTATAK 152 >05_01_0490 + 4083768-4083775,4083845-4084336,4084441-4084522, 4086671-4087357,4087555-4087813,4088435-4088558, 4089474-4089564 Length = 580 Score = 29.5 bits (63), Expect = 0.53 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +2 Query: 122 VRVVAGPHAGVISPMGIFRASIFGSAGLESH 214 +R + GP+ G+ +FR SIFG AG ES+ Sbjct: 247 MRRMFGPNGGIGIAEMLFRTSIFGLAGAESN 277 >06_02_0008 - 10552066-10552116,10552224-10552323,10552394-10552449, 10553950-10557180 Length = 1145 Score = 27.5 bits (58), Expect = 2.1 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = -3 Query: 229 LIVAVMALEASTTEYGCPENAHWTDDPCVRTCDDPYL 119 L++AV+A+ + P WTDD V DP L Sbjct: 101 LLLAVLAVSVTYNAGLSPPGGFWTDDSPVHHAGDPLL 137 >05_05_0051 + 21923402-21923763,21923861-21923951,21924048-21924196, 21924279-21924522,21924664-21924768,21924842-21925024, 21925118-21925319,21925896-21926372,21926680-21926771, 21927265-21927444 Length = 694 Score = 27.5 bits (58), Expect = 2.1 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = -3 Query: 166 HWTDDPCVRTCDDP 125 HWT PCV C DP Sbjct: 143 HWTFAPCVAVCRDP 156 >01_06_1440 + 37378121-37378958,37379344-37379494,37379567-37379936, 37380021-37380431,37380522-37380820,37380897-37381155, 37381248-37381497,37381744-37381875,37381936-37382208, 37383023-37383267 Length = 1075 Score = 27.1 bits (57), Expect = 2.8 Identities = 22/65 (33%), Positives = 28/65 (43%), Gaps = 4/65 (6%) Frame = +2 Query: 89 NEGADASGVSQVRVVAGPHAGVISPMGIFRASIFGSAGLESHHG----DNQEHDKVLFGG 256 + GA AS S + PHAG F A IFG+ SH G +Q +D L G Sbjct: 885 SSGAFASSSSHGASIPRPHAG-------FAAGIFGTGASSSHAGRTGPTSQFYDDDLHGA 937 Query: 257 HLRDI 271 D+ Sbjct: 938 DHHDV 942 >06_03_0548 + 22004338-22006746 Length = 802 Score = 26.6 bits (56), Expect = 3.7 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +3 Query: 105 QAVLVRYGSSQVLTQGSSVQWAFSGHPYSVVLASRAITATIR 230 QA L+ G+ V ++G ++ W P +L ++ ITA I+ Sbjct: 124 QAKLLNTGNLIVKSKGDTILWESFAFPTDTLLPTQNITARIK 165 >06_01_1044 - 8208126-8208230,8208468-8208536,8208640-8208711 Length = 81 Score = 26.6 bits (56), Expect = 3.7 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -3 Query: 175 ENAHWTDDPCVRTCDDPYLTNTACVGALIQ 86 EN HW D + C+ NTA G++ Q Sbjct: 47 ENIHWLCDLVISMCNTIRRENTALAGSICQ 76 >05_01_0290 + 2270749-2271037,2272227-2272363,2272660-2272805, 2272853-2272877 Length = 198 Score = 26.6 bits (56), Expect = 3.7 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +3 Query: 105 QAVLVRYGSSQVLTQGSSVQWAFSGHP 185 QA + +++LTQ SV WAFS P Sbjct: 156 QAAIKALDGTELLTQIISVDWAFSNGP 182 >02_04_0349 + 22222091-22222639,22222718-22223695 Length = 508 Score = 26.6 bits (56), Expect = 3.7 Identities = 14/41 (34%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = +3 Query: 93 RAPTQAVLVRYGSSQVLTQGSSVQ--WAFSGHPYSVVLASR 209 RAP V V YGS V++ V+ W +G Y+ + R Sbjct: 307 RAPRSVVYVNYGSIAVMSNQQLVEFAWGLAGSGYAFLWVIR 347 >01_06_1681 - 39129620-39130120 Length = 166 Score = 26.6 bits (56), Expect = 3.7 Identities = 10/36 (27%), Positives = 20/36 (55%) Frame = +2 Query: 185 IFGSAGLESHHGDNQEHDKVLFGGHLRDIFQTTAFQ 292 + S GL+ H G++++ ++ GGH R + A + Sbjct: 104 VTSSNGLQGHTGEDEDDNEEATGGHGRGVLPEVAVE 139 >01_06_1588 + 38474698-38477169 Length = 823 Score = 26.6 bits (56), Expect = 3.7 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = +3 Query: 96 APTQAVLVRYGSSQVLTQGSSVQWAFSGHPYSVVLASRAITATIR 230 A A L G+ V + G V W +P +L + +TAT R Sbjct: 122 AAAAAELTDSGNLVVTSHGGDVLWQSFDYPTDTLLPGQPVTATAR 166 >05_03_0317 - 12249228-12249275,12263876-12264518,12264954-12266682, 12283603-12283975,12284119-12284715 Length = 1129 Score = 26.2 bits (55), Expect = 4.9 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -3 Query: 73 NDGLVFNADRKCVPIS 26 NDG VF A++ C+P S Sbjct: 842 NDGFVFRANKLCIPAS 857 >01_07_0075 + 40908875-40909069,40909147-40909215,40909363-40909461, 40909999-40910078,40910162-40910444,40910557-40910580, 40911039-40911700,40912037-40912121,40912203-40912254, 40912336-40912385,40912450-40912497,40912590-40912766 Length = 607 Score = 26.2 bits (55), Expect = 4.9 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 197 AGLESHHGDNQEHDKVLFGGHLRDIFQTTA 286 A + SHH QEHD+ G + +I+ T A Sbjct: 280 AHVSSHHHYRQEHDRSSASGTVGNIYLTDA 309 >01_01_0824 + 6411899-6411931,6412001-6412210,6412302-6412451, 6413787-6413969,6417705-6417779,6417959-6418102, 6418233-6418418,6418515-6418694 Length = 386 Score = 26.2 bits (55), Expect = 4.9 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +3 Query: 111 VLVRYGSSQVLTQGSSVQWAFSGHPYSVV 197 +LVRY + + + +SVQW +G P +V Sbjct: 192 MLVRYDAGYTIDEVNSVQWKCNGTPKVLV 220 >02_05_0788 + 31758119-31758384,31758482-31758634,31759385-31759509, 31759650-31759678,31760943-31761008,31761059-31761125, 31761226-31761370,31761404-31761451,31762014-31762182, 31762645-31762779,31762858-31763064,31763608-31763735, 31763815-31763866,31764046-31764060,31764502-31764609 Length = 570 Score = 25.8 bits (54), Expect = 6.5 Identities = 15/42 (35%), Positives = 25/42 (59%) Frame = +3 Query: 108 AVLVRYGSSQVLTQGSSVQWAFSGHPYSVVLASRAITATIRN 233 ++L +GS + L + +V + FS VVLAS+ +TA + N Sbjct: 417 SLLAAHGSDKFLLR--NVLYMFSSIKEQVVLASKLVTAPVIN 456 >01_01_0156 - 1364856-1365401 Length = 181 Score = 25.8 bits (54), Expect = 6.5 Identities = 12/38 (31%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = -3 Query: 172 NAHWTDDPCVRTCDDPY---LTNTACVGALIQTCHCND 68 + +W DP P+ TNT C ++ C CND Sbjct: 101 DVYWGADPGPFCTPRPWGDCCTNTTCTRSIPPICRCND 138 >01_01_0027 - 205450-206029,206706-207276,207408-207836,208438-208525 Length = 555 Score = 25.8 bits (54), Expect = 6.5 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = -3 Query: 244 YFIVFLIVAVMALEASTTEYGCPENAHWTDDPCVRTC 134 +F F++ A + AST+ CP+ W P + C Sbjct: 11 FFFFFILPASLTATASTSTSSCPDG--WQITPALDKC 45 >09_06_0371 + 22615809-22617431,22618312-22618422,22619361-22619453, 22619562-22619661,22619754-22619834,22620774-22621047, 22621254-22622069,22622921-22623029,22623509-22623602, 22623881-22623939,22624150-22624197 Length = 1135 Score = 25.4 bits (53), Expect = 8.6 Identities = 15/52 (28%), Positives = 19/52 (36%) Frame = -3 Query: 223 VAVMALEASTTEYGCPENAHWTDDPCVRTCDDPYLTNTACVGALIQTCHCND 68 V ++AL ++ G A W TC P TN A L C D Sbjct: 199 VTLLALLSACAHLGALHTARWAHAYLATTCSFPITTNLA-TALLNMYMRCGD 249 >05_07_0226 - 28515052-28515064,28515426-28515502,28515610-28515767, 28515852-28515937,28516048-28516351,28516410-28517490 Length = 572 Score = 25.4 bits (53), Expect = 8.6 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +2 Query: 161 PMGIFRASIFGSAGLESHHGDNQEH 235 P RAS FG+A L S H +++H Sbjct: 264 PNSALRASSFGAADLFSLHSSSRQH 288 >04_01_0453 + 5869627-5870232,5870383-5870897,5870964-5871600 Length = 585 Score = 25.4 bits (53), Expect = 8.6 Identities = 13/47 (27%), Positives = 21/47 (44%) Frame = +2 Query: 98 ADASGVSQVRVVAGPHAGVISPMGIFRASIFGSAGLESHHGDNQEHD 238 A SG +GP AG + + +FG+ HG++ +HD Sbjct: 203 ARGSGAMFSNTSSGPTAGSSAGGFVPSGGVFGTGKDSKSHGESVQHD 249 >03_06_0402 + 33681451-33681706,33682800-33682936,33683103-33683153, 33683798-33683866,33684286-33684428,33685464-33685521, 33685823-33685938,33686298-33686391,33686950-33686961 Length = 311 Score = 25.4 bits (53), Expect = 8.6 Identities = 12/48 (25%), Positives = 23/48 (47%) Frame = +3 Query: 105 QAVLVRYGSSQVLTQGSSVQWAFSGHPYSVVLASRAITATIRNTIKYC 248 Q + +Q+LT+ V WAFS P + ++ ++ + I +C Sbjct: 185 QTAIKAMNGTQLLTRTVYVDWAFSRGPIQKLTSTSSVIMSKPQMIIHC 232 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,521,119 Number of Sequences: 37544 Number of extensions: 129200 Number of successful extensions: 390 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 382 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 390 length of database: 14,793,348 effective HSP length: 71 effective length of database: 12,127,724 effective search space used: 351703996 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -