BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11j17f (351 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g51510.1 68414.m05797 RNA-binding protein, putative similar t... 27 2.7 At3g08820.1 68416.m01024 pentatricopeptide (PPR) repeat-containi... 27 3.5 At5g50890.1 68418.m06308 hypothetical protein 27 4.6 At4g01995.1 68417.m00267 expressed protein 26 6.1 At2g47620.1 68415.m05941 SWIRM domain-containing protein / DNA-b... 26 6.1 At1g66730.1 68414.m07585 ATP dependent DNA ligase family protein... 26 6.1 At1g17750.1 68414.m02197 leucine-rich repeat transmembrane prote... 26 6.1 >At1g51510.1 68414.m05797 RNA-binding protein, putative similar to RNA-binding protein 8 (Ribonucleoprotein RBM8) SP:Q9Y5S9 from [Homo sapiens], RNA-binding protein Y14 [Xenopus laevis] GI:11034807; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 202 Score = 27.5 bits (58), Expect = 2.7 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -3 Query: 199 QAVLVRYGSSQVLTQGSSVQWAFSGHP 119 Q+ + +++LTQ SV WAFS P Sbjct: 150 QSAISAMNGAELLTQNVSVDWAFSSGP 176 >At3g08820.1 68416.m01024 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 685 Score = 27.1 bits (57), Expect = 3.5 Identities = 18/53 (33%), Positives = 22/53 (41%), Gaps = 4/53 (7%) Frame = +3 Query: 78 IVAVMALEASTTEYGCPEN----AHWTDDPCVRTCDDPYLTNTACVGALIQTC 224 I V AL+ + YGC + A DD CD P N GAL+ C Sbjct: 440 ISCVYALKRTVEHYGCMVDLWGRAGMLDDAYRLICDMPMRPNAIVWGALLSGC 492 >At5g50890.1 68418.m06308 hypothetical protein Length = 408 Score = 26.6 bits (56), Expect = 4.6 Identities = 17/45 (37%), Positives = 25/45 (55%) Frame = -3 Query: 262 FLSALKTKPSLQWQV*MRAPTQAVLVRYGSSQVLTQGSSVQWAFS 128 FL+ K S+++ V + A Q+V RYGSS V G S+ F+ Sbjct: 176 FLAWESLKGSVRFNVALEA-LQSVATRYGSSNVCVVGHSLGAGFA 219 >At4g01995.1 68417.m00267 expressed protein Length = 258 Score = 26.2 bits (55), Expect = 6.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 126 PENAHWTDDPCVRTCDDPYLTNTACVGALIQTC 224 P W V C YL + CVG I TC Sbjct: 162 PNGESWDSGVFVEKCQ--YLEESKCVGVCINTC 192 >At2g47620.1 68415.m05941 SWIRM domain-containing protein / DNA-binding family protein contains similarity to SWI/SNF complex 170 KDa subunit [Homo sapiens] gi|1549241|gb|AAC50694; contains Pfam domains PF04433: SWIRM domain, PF00249: Myb-like DNA-binding domain Length = 512 Score = 26.2 bits (55), Expect = 6.1 Identities = 16/46 (34%), Positives = 21/46 (45%) Frame = +3 Query: 15 ESCSLKNITKMAAKQYFIVFLIVAVMALEASTTEYGCPENAHWTDD 152 +S +K + MA+K V A AL A E CP+ TDD Sbjct: 336 DSSLMKQVAAMASKVGPSVATAAAKAALAALCDEASCPKEIFDTDD 381 >At1g66730.1 68414.m07585 ATP dependent DNA ligase family protein contains Pfam profile: PF01068 ATP dependent DNA ligase domain Length = 1417 Score = 26.2 bits (55), Expect = 6.1 Identities = 14/41 (34%), Positives = 19/41 (46%), Gaps = 5/41 (12%) Frame = +3 Query: 162 RTCD----DPYLTN-TACVGALIQTCHCNDGLVFNADRKCV 269 R CD DP+L C G + T +CN VF + + V Sbjct: 175 RFCDEMRFDPFLNGFVGCDGVFLDTTYCNPKFVFPSQEESV 215 >At1g17750.1 68414.m02197 leucine-rich repeat transmembrane protein kinase, putative similar to receptor-like protein kinase INRPK1 GI:1684913 from [Ipomoea nil] Length = 1088 Score = 26.2 bits (55), Expect = 6.1 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = -3 Query: 133 FSGHPYSVVLASRAITATIRNTIKYCLAAIFVIFFRLQL 17 FSG+P + AS +++A IR K C + + +++ L Sbjct: 702 FSGNPDLCIQASYSVSAIIRKEFKSCKGQVKLSTWKIAL 740 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,521,101 Number of Sequences: 28952 Number of extensions: 112122 Number of successful extensions: 307 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 307 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 307 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 439384704 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -