BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11j14r (384 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein ... 23 0.93 AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein ... 23 0.93 AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific pro... 23 0.93 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 23 1.2 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 21 6.5 >DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein 3 protein. Length = 130 Score = 23.4 bits (48), Expect = 0.93 Identities = 7/24 (29%), Positives = 17/24 (70%) Frame = +3 Query: 153 ISNNCSKYLNRKRGLFKNMIKYLI 224 ++ +C K +++R + K +IK+L+ Sbjct: 72 LATDCKKCTDKQREVIKKVIKFLV 95 >AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein protein. Length = 130 Score = 23.4 bits (48), Expect = 0.93 Identities = 7/24 (29%), Positives = 17/24 (70%) Frame = +3 Query: 153 ISNNCSKYLNRKRGLFKNMIKYLI 224 ++ +C K +++R + K +IK+L+ Sbjct: 72 LATDCKKCTDKQREVIKKVIKFLV 95 >AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific protein 3c precursor protein. Length = 130 Score = 23.4 bits (48), Expect = 0.93 Identities = 7/24 (29%), Positives = 17/24 (70%) Frame = +3 Query: 153 ISNNCSKYLNRKRGLFKNMIKYLI 224 ++ +C K +++R + K +IK+L+ Sbjct: 72 LATDCKKCTDKQREVIKKVIKFLV 95 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 23.0 bits (47), Expect = 1.2 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +3 Query: 123 LFYYLKRD*LISNNCSKYLNRKRGLFKNMIKY 218 LFYY+ + + NC + NR G K I + Sbjct: 233 LFYYMHQQIMARYNCERLCNR-LGRVKRFINW 263 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 20.6 bits (41), Expect = 6.5 Identities = 7/11 (63%), Positives = 10/11 (90%) Frame = +3 Query: 171 KYLNRKRGLFK 203 K+ NR+RG+FK Sbjct: 479 KWTNRERGVFK 489 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 99,187 Number of Sequences: 438 Number of extensions: 1922 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 9424380 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -