BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11j14f (563 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY994095-1|AAX86008.1| 144|Anopheles gambiae unknown protein. 45 1e-06 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 24 3.9 AY330177-1|AAQ16283.1| 166|Anopheles gambiae odorant-binding pr... 23 5.2 >AY994095-1|AAX86008.1| 144|Anopheles gambiae unknown protein. Length = 144 Score = 45.2 bits (102), Expect = 1e-06 Identities = 30/84 (35%), Positives = 40/84 (47%) Frame = +3 Query: 270 YHGESSNVDQVSVVDHPGEYDWVXXXXXXXSSLTGRAVVGGHEGWDGSPLWVIRAWHMGD 449 Y G+ + V+ V V+ H + W + AVVGGH DG L+V RA+H G Sbjct: 57 YGGQETLVEHVEVLVHK-QLIW---DTASAGQVPLGAVVGGHTS-DGEILYVGRAYHEGS 111 Query: 450 MIPGKLSVRHNAASIMYNGKEIPV 521 GK+ HN I Y G E+ V Sbjct: 112 QTIGKVQCSHNCIYIPYGGAEVSV 135 Score = 37.1 bits (82), Expect = 4e-04 Identities = 19/48 (39%), Positives = 29/48 (60%) Frame = +3 Query: 381 VVGGHEGWDGSPLWVIRAWHMGDMIPGKLSVRHNAASIMYNGKEIPVQ 524 V GG + DG+ ++V RA H GD++P K+ AA + Y G+E V+ Sbjct: 19 VPGGVDS-DGAQIFVGRAHHAGDLLPAKVIPDKTAAYVAYGGQETLVE 65 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 23.8 bits (49), Expect = 3.9 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = -3 Query: 96 GGEASEGQAGVGSKAEALRNI 34 GG G G GS A ALRN+ Sbjct: 169 GGGGGGGGGGAGSFAAALRNL 189 >AY330177-1|AAQ16283.1| 166|Anopheles gambiae odorant-binding protein AgamOBP50 protein. Length = 166 Score = 23.4 bits (48), Expect = 5.2 Identities = 12/46 (26%), Positives = 19/46 (41%) Frame = -2 Query: 514 ISLPLYIIEAALCLTDSFPGIMSPMCQALMTHKGLPSQPSCPPTTA 377 ++LP ++ CL+ I C L LP+ +C T A Sbjct: 3 VALPFSVVGKLTCLSPFLQSIKVASCCQLEAFLTLPTYGNCLQTIA 48 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 521,622 Number of Sequences: 2352 Number of extensions: 9829 Number of successful extensions: 46 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 42 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 46 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52983882 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -