BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11j12r (742 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY219181-1|AAO60072.1| 4243|Homo sapiens fibrocystin L protein. 33 1.1 AY312160-1|AAQ82434.1| 1569|Homo sapiens mucin glycoprotein prot... 31 3.3 U72355-1|AAC00056.1| 915|Homo sapiens Hsp27 ERE-TATA-binding pr... 31 4.3 L43631-1|AAC18697.1| 864|Homo sapiens scaffold attachment facto... 31 4.3 BC126219-1|AAI26220.1| 917|Homo sapiens scaffold attachment fac... 31 4.3 AB208780-1|BAD92017.1| 772|Homo sapiens scaffold attachment fac... 31 4.3 >AY219181-1|AAO60072.1| 4243|Homo sapiens fibrocystin L protein. Length = 4243 Score = 33.1 bits (72), Expect = 1.1 Identities = 29/91 (31%), Positives = 49/91 (53%), Gaps = 1/91 (1%) Frame = -2 Query: 540 VEKAEGDYTFPISDIFSASGTVAELALEGISNVVVNDVTFNLLRPTTFSIDLALPKLSAS 361 +++ DYT + +I S +GT AE A E +S V D++ + P T+++ L P + + Sbjct: 2040 IDRLRSDYTTLLCEIPSNNGTGAEQACE-VSVVNGKDLS-QSMTPFTYAVSLT-PLI--T 2094 Query: 360 AVAVNGQATIFGRELAVASSG-SLVVEDIRL 271 AV+ +T G L V SG S +ED+ + Sbjct: 2095 AVSPKRGSTAGGTRLTVVGSGFSENMEDVHI 2125 >AY312160-1|AAQ82434.1| 1569|Homo sapiens mucin glycoprotein protein. Length = 1569 Score = 31.5 bits (68), Expect = 3.3 Identities = 18/60 (30%), Positives = 27/60 (45%) Frame = +2 Query: 155 TSLPKRTTLRADSTLPTVRTALSSLTLMLGSNRKLTVETRRISSTTRLPLLATANSLPKM 334 + LP TLR+ +T PTV A + T S + +T LP AT+ + P + Sbjct: 1283 SGLPPTATLRSTATKPTVTQATTRATASTASPATTSTAQSTTRTTMTLPTPATSGTSPTL 1342 >U72355-1|AAC00056.1| 915|Homo sapiens Hsp27 ERE-TATA-binding protein protein. Length = 915 Score = 31.1 bits (67), Expect = 4.3 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +1 Query: 376 GEGKVDAECSWSQKVESDVIDDNVADALESQFGYCARCAED 498 G+G+ D E S + D++D +V D E G A C ED Sbjct: 110 GDGQEDVETSLENLQDIDIMDISVLDEAEIDNGSVADCVED 150 >L43631-1|AAC18697.1| 864|Homo sapiens scaffold attachment factor B protein. Length = 864 Score = 31.1 bits (67), Expect = 4.3 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +1 Query: 376 GEGKVDAECSWSQKVESDVIDDNVADALESQFGYCARCAED 498 G+G+ D E S + D++D +V D E G A C ED Sbjct: 59 GDGQEDVETSLENLQDIDIMDISVLDEAEIDNGSVADCVED 99 >BC126219-1|AAI26220.1| 917|Homo sapiens scaffold attachment factor B protein. Length = 917 Score = 31.1 bits (67), Expect = 4.3 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +1 Query: 376 GEGKVDAECSWSQKVESDVIDDNVADALESQFGYCARCAED 498 G+G+ D E S + D++D +V D E G A C ED Sbjct: 110 GDGQEDVETSLENLQDIDIMDISVLDEAEIDNGSVADCVED 150 >AB208780-1|BAD92017.1| 772|Homo sapiens scaffold attachment factor B variant protein. Length = 772 Score = 31.1 bits (67), Expect = 4.3 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +1 Query: 376 GEGKVDAECSWSQKVESDVIDDNVADALESQFGYCARCAED 498 G+G+ D E S + D++D +V D E G A C ED Sbjct: 130 GDGQEDVETSLENLQDIDIMDISVLDEAEIDNGSVADCVED 170 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 86,477,322 Number of Sequences: 237096 Number of extensions: 1644106 Number of successful extensions: 3985 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3824 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3985 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8847149012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -