BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11j12f (590 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_32671| Best HMM Match : SerH (HMM E-Value=0.4) 42 5e-04 SB_23620| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.74) 31 0.93 SB_20908| Best HMM Match : C4dic_mal_tran (HMM E-Value=0.053) 31 0.93 SB_23144| Best HMM Match : Biotin_lipoyl (HMM E-Value=9.8) 28 6.6 SB_16235| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_48138| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_24621| Best HMM Match : DUF164 (HMM E-Value=0.39) 28 6.6 SB_41234| Best HMM Match : CASP_C (HMM E-Value=0.79) 27 8.7 SB_30055| Best HMM Match : Histone (HMM E-Value=0.97) 27 8.7 SB_31640| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 >SB_32671| Best HMM Match : SerH (HMM E-Value=0.4) Length = 406 Score = 41.5 bits (93), Expect = 5e-04 Identities = 41/127 (32%), Positives = 59/127 (46%) Frame = -3 Query: 582 LPKRTTLRADSTLPTVRTALSSLTLMLGSNRKLTVETRRISSTTRLPLLATANSLPKMVA 403 LP+ ++L+A S PT + S ++L SN K + T STT L L + SL Sbjct: 124 LPRTSSLKASSNTPTALSTTSLMSLPSTSNLKASSNTPTALSTTSLMSLPSTPSLEAS-- 181 Query: 402 *PLTATAEALSLGRARSMLNVVGLKRLKVTSLTTTLLMPSRANSATVPDALKMSEIGKV* 223 + T ALS A S++++ L+ +S T T L + S +LK S Sbjct: 182 ---SNTPTALS---ATSLMSLPSTSSLEASSNTPTALSATSLMSLPSTSSLKASSN---- 231 Query: 222 SPSAFST 202 SPSA ST Sbjct: 232 SPSALST 238 Score = 34.3 bits (75), Expect = 0.076 Identities = 32/118 (27%), Positives = 51/118 (43%), Gaps = 2/118 (1%) Frame = -3 Query: 585 SLPKRTTLRADSTLPTVRTALSSLTLMLGSNRKLTVETRRISSTTRLPLLATANSLPKMV 406 SLP + L+A S PT + S ++L + + + T S T L L + +SL Sbjct: 147 SLPSTSNLKASSNTPTALSTTSLMSLPSTPSLEASSNTPTALSATSLMSLPSTSSLEASS 206 Query: 405 A*PLTATAEAL-SLGRARSM-LNVVGLKRLKVTSLTTTLLMPSRANSATVPDALKMSE 238 P +A +L SL S+ + L TSL + + PS A V ++ S+ Sbjct: 207 NTPTALSATSLMSLPSTSSLKASSNSPSALSTTSLLSFSIQPSSATPIQVSSSVTTSD 264 >SB_23620| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.74) Length = 483 Score = 30.7 bits (66), Expect = 0.93 Identities = 17/63 (26%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Frame = -2 Query: 487 ADSGD-QTNIFDDKASTTGYSQFPAKDGGLTVDGDSRGAEFGEGKVDAECSWSQKVESDV 311 AD G Q+ I D+ + G K G+ +G+ + EGK +E + K S + Sbjct: 378 ADEGKTQSGIADEGKTQNGVVDEEKKQSGVVDEGERQSGIADEGKTQSEIADEGKTHSGI 437 Query: 310 IDD 302 +D+ Sbjct: 438 VDE 440 >SB_20908| Best HMM Match : C4dic_mal_tran (HMM E-Value=0.053) Length = 576 Score = 30.7 bits (66), Expect = 0.93 Identities = 18/92 (19%), Positives = 38/92 (41%) Frame = +2 Query: 257 SGTVAELALEGISNVVVNDVTFNLLRPTTFSIDLALPKLSASAVAVNGQATIFGRELAVA 436 + TV A+ + V V FN + + + ++S V + AT+ + ++ Sbjct: 390 AATVVSKAISTVGLGVAATVVFNAISTVELGVAATVVSKASSTVELGVAATVVSKAISTV 449 Query: 437 SSGSLVVEDIRLVSTVSLRLLPSINVRELSAV 532 G + +STV L + ++ + +S V Sbjct: 450 GLGVAATVVSKAISTVGLGMAATVVFKAISTV 481 Score = 27.5 bits (58), Expect = 8.7 Identities = 19/94 (20%), Positives = 38/94 (40%), Gaps = 3/94 (3%) Frame = +2 Query: 260 GTVAELALEGISNV---VVNDVTFNLLRPTTFSIDLALPKLSASAVAVNGQATIFGRELA 430 G A + + IS V + V FN + + + ++S V + AT+ + ++ Sbjct: 324 GMAATVVFKAISTVGLGMAATVVFNAISTVELGVAATVVSKASSTVELGVAATVVSKAIS 383 Query: 431 VASSGSLVVEDIRLVSTVSLRLLPSINVRELSAV 532 G + +STV L + ++ +S V Sbjct: 384 TVGLGVAATVVSKAISTVGLGVAATVVFNAISTV 417 >SB_23144| Best HMM Match : Biotin_lipoyl (HMM E-Value=9.8) Length = 929 Score = 27.9 bits (59), Expect = 6.6 Identities = 21/87 (24%), Positives = 33/87 (37%) Frame = -2 Query: 487 ADSGDQTNIFDDKASTTGYSQFPAKDGGLTVDGDSRGAEFGEGKVDAECSWSQKVESDVI 308 +D D +N+ D + A DG DG S G + G D + + D + Sbjct: 282 SDGDDVSNVASDGDDVSNV----ASDGDDVSDGSSDGDDVSNGSSDGDDVSDGSSDGDDV 337 Query: 307 DDNVADALESQFGYCARCAEDVRNWES 227 + V+D + G +DV N S Sbjct: 338 SNGVSDGDDVSDGDVVVTIDDVSNGAS 364 >SB_16235| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4072 Score = 27.9 bits (59), Expect = 6.6 Identities = 26/74 (35%), Positives = 30/74 (40%), Gaps = 1/74 (1%) Frame = -3 Query: 588 TSLPKRTTLRADSTLPTVRTALSSLTLMLGSNRKLTVETRRISSTTRLPLLATANSLPKM 409 T LPK T +TLP A + TL ET + TT P T LPK Sbjct: 2980 TPLPKTTAAPETTTLPKTTAAPETTTL---PKTTAAPETTTLPKTTAAPETTT---LPKT 3033 Query: 408 VA*P-LTATAEALS 370 A P TA E+ S Sbjct: 3034 TAAPETTAVHESTS 3047 >SB_48138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1913 Score = 27.9 bits (59), Expect = 6.6 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 148 VHDQFFDQILAFSVKVNF*GHSNDAGSE 65 + D+ FD +L FS + F H ND +E Sbjct: 280 ISDEHFDNLLVFSAEAKFDLHGNDLTNE 307 >SB_24621| Best HMM Match : DUF164 (HMM E-Value=0.39) Length = 566 Score = 27.9 bits (59), Expect = 6.6 Identities = 32/101 (31%), Positives = 49/101 (48%), Gaps = 3/101 (2%) Frame = -3 Query: 585 SLPKRTTLRADSTLPTVRTALSSLTL-MLGSNRKLTVETRRISSTTRLPLLATANSLPKM 409 SL K+ L L ++ L SLT +L +KL T+++ S T+ LL+ L + Sbjct: 347 SLTKKL-LSLTKKLQSLTKKLLSLTKKLLSLTKKLLSLTKKLQSLTK-KLLSLTKKLLSL 404 Query: 408 VA*PLTATAEALSLGRARSML--NVVGLKRLKVTSLTTTLL 292 PL+ T + LSL + L ++ L + K SLT LL Sbjct: 405 TKKPLSLTKKLLSLTKKLLSLTKKLLSLTK-KPLSLTKKLL 444 >SB_41234| Best HMM Match : CASP_C (HMM E-Value=0.79) Length = 296 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -2 Query: 412 DGGLTVDGDSRGAEFGEGKVDAEC 341 DGG DGD G + G+G D +C Sbjct: 234 DGGGDDDGDGDGVDDGDGDGDGDC 257 >SB_30055| Best HMM Match : Histone (HMM E-Value=0.97) Length = 129 Score = 27.5 bits (58), Expect = 8.7 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = -2 Query: 451 KASTTGYSQFPAKDGGLTVDGDSRGAEFGEGK 356 K T G FPA+DGGL V G G+ K Sbjct: 52 KEQTNGRLDFPARDGGLLVVMTMSGRGKGKAK 83 >SB_31640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3003 Score = 27.5 bits (58), Expect = 8.7 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = -2 Query: 400 TVDGDSRGAEFGEGKVDAECSWSQKV--ESDVIDDNVADALE 281 ++DGD G+E G + CS Q+ ES+ +D + +L+ Sbjct: 1237 SIDGDRGGSETGHRSTSSHCSDDQRAQEESEALDHDRLHSLQ 1278 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,655,860 Number of Sequences: 59808 Number of extensions: 300821 Number of successful extensions: 1162 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 968 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1151 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1434459094 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -