BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11j10f (597 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5903| Best HMM Match : No HMM Matches (HMM E-Value=.) 235 1e-62 SB_31650| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_20161| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.057 SB_23205| Best HMM Match : Helicase_C (HMM E-Value=3.9e-14) 34 0.076 SB_12331| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_320| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_15301| Best HMM Match : Kelch_1 (HMM E-Value=0) 32 0.31 SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) 32 0.40 SB_53556| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.93 SB_21400| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.93 SB_13696| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.93 SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_52106| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0098) 29 2.2 SB_59515| Best HMM Match : Pox_A_type_inc (HMM E-Value=3.2e-31) 29 2.9 SB_53343| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_35649| Best HMM Match : M (HMM E-Value=6e-09) 29 2.9 SB_21874| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_36974| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_22161| Best HMM Match : Vicilin_N (HMM E-Value=0.11) 29 3.8 SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) 29 3.8 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_41890| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 28 5.0 SB_10355| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0037) 28 5.0 SB_48789| Best HMM Match : M (HMM E-Value=1.3e-10) 28 5.0 SB_46136| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_56573| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_41319| Best HMM Match : NACHT (HMM E-Value=5.2e-14) 28 6.6 SB_32475| Best HMM Match : IWS1_C (HMM E-Value=0) 28 6.6 SB_29265| Best HMM Match : OmpH (HMM E-Value=3) 28 6.6 SB_4879| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_38518| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_37864| Best HMM Match : Extensin_2 (HMM E-Value=0.064) 27 8.7 SB_27802| Best HMM Match : Filament (HMM E-Value=0.2) 27 8.7 SB_45719| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_18003| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_7056| Best HMM Match : Seryl_tRNA_N (HMM E-Value=8.1) 27 8.7 SB_4536| Best HMM Match : Krr1 (HMM E-Value=4) 27 8.7 SB_3154| Best HMM Match : DUF812 (HMM E-Value=1.8) 27 8.7 >SB_5903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 235 bits (576), Expect = 1e-62 Identities = 129/169 (76%), Positives = 135/169 (79%), Gaps = 1/169 (0%) Frame = +2 Query: 92 MATTLEDKSIWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQND 271 MA TLEDK+IW DGEE + EEVLRM TDEIVSR RLLDNEI Sbjct: 1 MAATLEDKAIWGDGEE-MGEEVLRMSTDEIVSRARLLDNEI------------------- 40 Query: 272 KIKENTEKIKVNKTLPYLVSNVIELLDVDPQE-EEEDGAVVDLDSQRKGKCAVIKTSTRQ 448 KEN+EKIKVNKTLPYLVSNVIELLDVDPQ+ EEDGA VDLDSQRKGKCAVIKTSTRQ Sbjct: 41 --KENSEKIKVNKTLPYLVSNVIELLDVDPQDYAEEDGANVDLDSQRKGKCAVIKTSTRQ 98 Query: 449 TYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPAEYDARVKAMEVDE 595 TYFLPVIGLV+ E L PGDLVGVNKDSYLILE LPAEYD+RVKAMEVDE Sbjct: 99 TYFLPVIGLVEPENLTPGDLVGVNKDSYLILEKLPAEYDSRVKAMEVDE 147 >SB_31650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3212 Score = 35.9 bits (79), Expect = 0.025 Identities = 30/128 (23%), Positives = 60/128 (46%), Gaps = 2/128 (1%) Frame = +2 Query: 68 EKTNHNITMATTLEDKSIWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKI--MKSEVMR 241 +K+ I + L D W+D +L EV ++ D+ + +++D+E ++ ++S + + Sbjct: 2590 DKSTATIHLEVELSD---WKDQASSLQSEVAQLKKDKAAAMHKVIDSEEQMIQLRSRLYK 2646 Query: 242 ISHELQAQNDKIKENTEKIKVNKTLPYLVSNVIELLDVDPQEEEEDGAVVDLDSQRKGKC 421 L D +K + K N L + + L V E ++ +VD + + K KC Sbjct: 2647 TEDSLVRNQDTVKLLS---KENTDLRVEIERLRSRLSVYASETAKE--IVDGNGEGKAKC 2701 Query: 422 AVIKTSTR 445 V+ T T+ Sbjct: 2702 GVV-TKTK 2708 >SB_20161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 475 Score = 34.7 bits (76), Expect = 0.057 Identities = 20/84 (23%), Positives = 46/84 (54%), Gaps = 2/84 (2%) Frame = +2 Query: 173 DEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKIKVNK-TLPYLVSNVIELL 349 + + S R +NEI +K+ + R+ EL++ +++ ++EKI ++ + L ++ + Sbjct: 105 ESVTSELRGRENEIAELKTSIGRLESELRSLKSELQNSSEKISEDEHEISQLKNDKARCM 164 Query: 350 -DVDPQEEEEDGAVVDLDSQRKGK 418 ++ + E+ + VVDL RK + Sbjct: 165 QELRDEREKSNKLVVDLQKTRKAQ 188 >SB_23205| Best HMM Match : Helicase_C (HMM E-Value=3.9e-14) Length = 1197 Score = 34.3 bits (75), Expect = 0.076 Identities = 28/100 (28%), Positives = 47/100 (47%), Gaps = 4/100 (4%) Frame = +2 Query: 110 DKSIWEDGEEALSEEVLRMPT--DEIVSRTRLLDNEIKIMKSE--VMRISHELQAQNDKI 277 D+ WE+ ++ L M T DE + + E K E + + ++ AQ +I Sbjct: 391 DREEWEEEQKRLDRAWYDMDTGYDETQNPFADVSEEYTKKKEEKLIKKAVKKMSAQQRQI 450 Query: 278 KENTEKIKVNKTLPYLVSNVIELLDVDPQEEEEDGAVVDL 397 ++ + + N+ L S V++ LDVD EEE+ A V L Sbjct: 451 NKDNDMWETNRML---TSGVVQKLDVDEDFEEENEAKVHL 487 >SB_12331| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 748 Score = 33.1 bits (72), Expect = 0.18 Identities = 27/115 (23%), Positives = 51/115 (44%), Gaps = 3/115 (2%) Frame = +2 Query: 77 NHNITMATTLEDKSIWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHEL 256 N NIT E I +DG+E E++ PT + +L DN ++ E +L Sbjct: 585 NMNITFKAHREVNRIEQDGQEVQEEQLEDNPTVPLGQEEQLEDNPTVPLEQE-----EQL 639 Query: 257 QAQNDKIKENTEKIKVNKTLPYLVSNVIE---LLDVDPQEEEEDGAVVDLDSQRK 412 + E ++++ N T+P +E + ++ +E+ ED V L+ + + Sbjct: 640 EDNPTVPLEQEQQLEDNPTVPLEQEEQLEDNPTVPLEQEEQLEDNPTVPLEQEEQ 694 >SB_320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1040 Score = 33.1 bits (72), Expect = 0.18 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = +2 Query: 230 EVMRISHELQAQNDKIKENTEKIK-VNKTLPYLVSNVIELLD 352 E+ + +EL+ Q + IKEN EK+K K + L +IEL D Sbjct: 612 EITELENELEEQREIIKENEEKLKEKEKEIEKLKKKIIELSD 653 >SB_15301| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 590 Score = 32.3 bits (70), Expect = 0.31 Identities = 17/58 (29%), Positives = 33/58 (56%), Gaps = 3/58 (5%) Frame = +2 Query: 200 LDNEIKIMKSEVMRISHELQAQNDKIKENTEKIKVNKTLPYLVSNVI---ELLDVDPQ 364 ++NE K+ ++ V ++H+L + D E E I++ PY + +V+ EL+ V P+ Sbjct: 191 VENEEKVYEALVRWVNHDLSQRRDLFPELLELIRLPLVSPYYLVDVVEKEELMTVSPR 248 >SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) Length = 5087 Score = 31.9 bits (69), Expect = 0.40 Identities = 25/107 (23%), Positives = 54/107 (50%), Gaps = 2/107 (1%) Frame = +2 Query: 104 LEDKSIWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKE 283 + ++ + E+ E EE +++ + + E+++M + + HE + +++IKE Sbjct: 2909 ISEEELLEEVEVQRVEEGASHDLEDVPALKESYEEEVEVM---AVGLKHEERVNDEEIKE 2965 Query: 284 NTEKIKVNKTLPYLVSNVIELLDVDPQEEEEDGAVVDL--DSQRKGK 418 EKI +++ N+I+ L+ +EE E AV + +R+GK Sbjct: 2966 KDEKIHLDE------ENIIQDLEETFEEELEVSAVETSKNEDERRGK 3006 >SB_53556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1524 Score = 30.7 bits (66), Expect = 0.93 Identities = 25/98 (25%), Positives = 47/98 (47%), Gaps = 2/98 (2%) Frame = +2 Query: 125 EDGEEALSEEVL--RMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKI 298 EDG E L E++ R E+ R + L+ E +++ +V + ++ + KIK+ EK+ Sbjct: 408 EDGTE-LEEKIRSQRNRITELERRVKELEKEKNLLEQQVKTMKNKSDDDDKKIKDLNEKV 466 Query: 299 KVNKTLPYLVSNVIELLDVDPQEEEEDGAVVDLDSQRK 412 +V + L N E+ + E + + DL + K Sbjct: 467 RVLE--KQLKENDAEIQGLKDDNERLEDELEDLSTTIK 502 Score = 30.3 bits (65), Expect = 1.2 Identities = 19/68 (27%), Positives = 36/68 (52%), Gaps = 1/68 (1%) Frame = +2 Query: 173 DEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKIKVNKTLPYLVSNVIELLD 352 DE++ + L ++ ++ EV ++ EL+ + ++TEK+ N + ++EL Sbjct: 716 DELMKQNESLRKKVSKLEDEVRFLNDELREADSSSIKDTEKL--NAEIREFKKKIVELEK 773 Query: 353 -VDPQEEE 373 VD QEEE Sbjct: 774 LVDDQEEE 781 >SB_21400| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1531 Score = 30.7 bits (66), Expect = 0.93 Identities = 30/109 (27%), Positives = 48/109 (44%), Gaps = 9/109 (8%) Frame = +2 Query: 149 EEVLRMPTDEIVSR---TRLLDNEIKIMKSEVMRISHELQAQND------KIKENTEKIK 301 EE LR +E+ R LDNE+ ++++ +L+ D ++ E E+ K Sbjct: 909 EEKLRRTEEELKDRDGQVAKLDNELTKLQNDFQDTITQLKTLEDLLDTSKRVVEEKEQ-K 967 Query: 302 VNKTLPYLVSNVIELLDVDPQEEEEDGAVVDLDSQRKGKCAVIKTSTRQ 448 V + L +V EL D +E+DG + +LD K IK Q Sbjct: 968 VTELDKLLNESVDELQQKDKSLKEKDGKLAELDQALKESRKEIKNREAQ 1016 >SB_13696| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 676 Score = 30.7 bits (66), Expect = 0.93 Identities = 19/70 (27%), Positives = 32/70 (45%), Gaps = 1/70 (1%) Frame = +2 Query: 101 TLEDKSIWEDGEEALSEEVLRMPTDEIVSRTR-LLDNEIKIMKSEVMRISHELQAQNDKI 277 TL+D+ W + E + + + DE++S R + I I V I ++A Sbjct: 502 TLDDEQGWVEPEPEVDAKRSCLKDDELLSMVRNIKAAHITITGEPVPEIEERMRAMTTAS 561 Query: 278 KENTEKIKVN 307 EN E +K+N Sbjct: 562 NENKELVKLN 571 >SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1448 Score = 30.3 bits (65), Expect = 1.2 Identities = 16/46 (34%), Positives = 26/46 (56%) Frame = +2 Query: 272 KIKENTEKIKVNKTLPYLVSNVIELLDVDPQEEEEDGAVVDLDSQR 409 K+K ++ + NKT + N +E D +P+E EED V D++R Sbjct: 510 KLKSKMKRSEKNKTEELVAVNKVETDDDNPEETEEDSGNVS-DTER 554 >SB_52106| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0098) Length = 1177 Score = 29.5 bits (63), Expect = 2.2 Identities = 23/91 (25%), Positives = 48/91 (52%), Gaps = 2/91 (2%) Frame = +2 Query: 35 VQELLNLKDYYEKTNHNIT--MATTLEDKSIWEDGEEALSEEVLRMPTDEIVSRTRLLDN 208 ++E L + +E T +++ +AT ++ K + EAL L+ ++ + L Sbjct: 185 LEEQLKAETQHESTLRDLSSQLATAVQQK----EELEALRARELKANREDYQKKCESLMV 240 Query: 209 EIKIMKSEVMRISHELQAQNDKIKENTEKIK 301 EI+ +KSEV +++ LQ Q D+++ + +K Sbjct: 241 EIESLKSEVQQLNSRLQNQ-DELETERKTLK 270 >SB_59515| Best HMM Match : Pox_A_type_inc (HMM E-Value=3.2e-31) Length = 2122 Score = 29.1 bits (62), Expect = 2.9 Identities = 27/94 (28%), Positives = 46/94 (48%), Gaps = 14/94 (14%) Frame = +2 Query: 47 LNLKDYYEKTNHNITM-----ATTLEDKSIWED---GEEALSE---EVLRM---PTDEIV 184 LN KDY ++ N T+ LE+K + G + ++E E+ +M PT+ + Sbjct: 1593 LNNKDYIQQRTDNQTLRQENETVLLENKDLKAQIAAGLKKMAEYEREITKMGQRPTEVVK 1652 Query: 185 SRTRLLDNEIKIMKSEVMRISHELQAQNDKIKEN 286 R R D+EI+ E+ + EL+ Q ++EN Sbjct: 1653 RRGRRGDSEIQRENIELQKRIAELEIQRKSVEEN 1686 Score = 27.9 bits (59), Expect = 6.6 Identities = 18/75 (24%), Positives = 34/75 (45%), Gaps = 2/75 (2%) Frame = +2 Query: 56 KDYYEKTNHNITMATTLEDKS--IWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKS 229 +D YEK N + M +++ I + A + +L+ +E + + EIK ++S Sbjct: 1193 EDLYEKENEVVVMKKRVKEFELLISNSNDSAAKDSLLKTVKNE----NEIQEKEIKKLRS 1248 Query: 230 EVMRISHELQAQNDK 274 EV+ + E K Sbjct: 1249 EVLELQREASGAQGK 1263 >SB_53343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 779 Score = 29.1 bits (62), Expect = 2.9 Identities = 14/54 (25%), Positives = 27/54 (50%) Frame = +2 Query: 134 EEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEK 295 + A+ E++ D VS R+ +NE+++ KSE + +Q K + E+ Sbjct: 121 QTAIQLEIVNFNDDSFVSGNRMSNNEVRVTKSESLSSPSNSYSQAFKSNNSREE 174 >SB_35649| Best HMM Match : M (HMM E-Value=6e-09) Length = 1279 Score = 29.1 bits (62), Expect = 2.9 Identities = 18/64 (28%), Positives = 33/64 (51%), Gaps = 3/64 (4%) Frame = +2 Query: 101 TLEDKSIWED---GEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQND 271 +LE+K +D E S E DE+V R L +E+K +K E + ++++ N Sbjct: 682 SLEEKIRLKDVVIDELKTSLETCSKERDELVESNRNLGSELKALKKENEELVSQVESLNQ 741 Query: 272 KIKE 283 K+++ Sbjct: 742 KVEQ 745 >SB_21874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 608 Score = 29.1 bits (62), Expect = 2.9 Identities = 23/86 (26%), Positives = 38/86 (44%) Frame = +2 Query: 56 KDYYEKTNHNITMATTLEDKSIWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEV 235 K+ +KT N T E+K ++ ++ E + T E +T+ ++ K K + Sbjct: 458 KENKDKTKEN--KDKTKENKDKTKENKDKTKEN--KDKTKENKDKTKNNKDKTKENKDKT 513 Query: 236 MRISHELQAQNDKIKENTEKIKVNKT 313 + + DK KEN K K NKT Sbjct: 514 NENKDKTKENKDKTKENKNKTKENKT 539 >SB_36974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 634 Score = 28.7 bits (61), Expect = 3.8 Identities = 9/18 (50%), Positives = 16/18 (88%) Frame = +2 Query: 341 ELLDVDPQEEEEDGAVVD 394 +++D+ PQ+EEEDG V++ Sbjct: 527 DIVDLQPQDEEEDGEVIE 544 >SB_22161| Best HMM Match : Vicilin_N (HMM E-Value=0.11) Length = 489 Score = 28.7 bits (61), Expect = 3.8 Identities = 30/136 (22%), Positives = 57/136 (41%), Gaps = 1/136 (0%) Frame = +2 Query: 65 YEKTNHNITMATTLEDKSIWEDGEEALSEEV-LRMPTDEIVSRTRLLDNEIKIMKSEVMR 241 Y++ ++ + LE K W + EEA + V L+ ++ + E M+ ++ Sbjct: 51 YKERERHMEIVQLLEKKRPWAEYEEARKQFVDLKTKREDAKKQLDQCRRENAPMEQQLNA 110 Query: 242 ISHELQAQNDKIKENTEKIKVNKTLPYLVSNVIELLDVDPQEEEEDGAVVDLDSQRKGKC 421 I L + +K+ EK S+ +E L VD EE+++ + D+ + K + Sbjct: 111 IVQHLCQLDRNMKQQAEKGSETHRKAKAKSDQLEAL-VDKIEEQQN-HLKDMQDEEKRRH 168 Query: 422 AVIKTSTRQTYFLPVI 469 T + F P I Sbjct: 169 KNFSTLIGKLLFQPKI 184 >SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) Length = 1106 Score = 28.7 bits (61), Expect = 3.8 Identities = 9/18 (50%), Positives = 16/18 (88%) Frame = +2 Query: 341 ELLDVDPQEEEEDGAVVD 394 +++D+ PQ+EEEDG V++ Sbjct: 982 DIVDLQPQDEEEDGEVIE 999 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 28.7 bits (61), Expect = 3.8 Identities = 9/18 (50%), Positives = 16/18 (88%) Frame = +2 Query: 341 ELLDVDPQEEEEDGAVVD 394 +++D+ PQ+EEEDG V++ Sbjct: 22 DIVDLQPQDEEEDGEVIE 39 >SB_41890| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 28.3 bits (60), Expect = 5.0 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +2 Query: 203 DNEIKIMKSEVMRISHELQAQNDKIKENTEKIKVNKTLPYLVSNVIE 343 D +K + SE ++ EL Q DKI KIK+ P + ++IE Sbjct: 104 DQPMKKLGSEFETVTGELLTQLDKISRGVRKIKLVSGDPRDIQSLIE 150 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 28.3 bits (60), Expect = 5.0 Identities = 17/69 (24%), Positives = 30/69 (43%) Frame = +2 Query: 113 KSIWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTE 292 KS+ + G+ + DE+ R L+ E+K +KSE + Q N ++ Sbjct: 224 KSLKKGGDLLFPGASYKRKLDEVAGRLDELEREVKRLKSETCQTKMTCQPCNHQLLMVGP 283 Query: 293 KIKVNKTLP 319 + + TLP Sbjct: 284 TVPIPPTLP 292 >SB_10355| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0037) Length = 1127 Score = 28.3 bits (60), Expect = 5.0 Identities = 14/51 (27%), Positives = 27/51 (52%) Frame = +2 Query: 125 EDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKI 277 ++ E L + LR E S+ + LD+E+ + + ++ HELQ + +I Sbjct: 910 QEAEFELKLDDLRADIQERDSQIKELDSEMAEVTENIAKLQHELQGKGQEI 960 >SB_48789| Best HMM Match : M (HMM E-Value=1.3e-10) Length = 2478 Score = 28.3 bits (60), Expect = 5.0 Identities = 32/145 (22%), Positives = 58/145 (40%), Gaps = 9/145 (6%) Frame = +2 Query: 44 LLNLKDYYEKTNHN-ITMATTLEDKSIWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKI 220 L+NL+ K + T LE + E L++ L M + + L+N ++ Sbjct: 791 LVNLQSLQNKLERSEFETRTRLEGQVEALQKESNLAKRQLEMDNTHHKNLIKTLENRVQE 850 Query: 221 MKSEVMRISHELQAQNDKIKENTEKI--------KVNKTLPYLVSNVIELLDVDPQEEEE 376 +++++ S Q D + NT+++ +V L V ELL +P ++ Sbjct: 851 LQTQIDTESRSNQQARDMLVRNTKEMERLEFKNTEVKAQLEAAEKRVHELLSKEPSSDQ- 909 Query: 377 DGAVVDLDSQRKGKCAVIKTSTRQT 451 D+D RK KT + T Sbjct: 910 -----DIDKMRKETEEKFKTDLQDT 929 >SB_46136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 28.3 bits (60), Expect = 5.0 Identities = 16/63 (25%), Positives = 33/63 (52%), Gaps = 1/63 (1%) Frame = +2 Query: 164 MPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDK-IKENTEKIKVNKTLPYLVSNVI 340 M TD+ L+ ++ M SE++R+ + A++DK ++ E I+ L+ ++ Sbjct: 76 METDQANQSVSDLEGIVQSMGSEILRLQSLVSAEDDKMLRYKVENIRRKHNYIPLIMEML 135 Query: 341 ELL 349 +LL Sbjct: 136 KLL 138 >SB_56573| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 641 Score = 27.9 bits (59), Expect = 6.6 Identities = 16/46 (34%), Positives = 27/46 (58%) Frame = +2 Query: 119 IWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHEL 256 I E +E ++ R+ EI+S+T +L ++IK + VMRI E+ Sbjct: 196 IIEGKKEFKLADLGRVTLKEIISKTSVLVSDIKGSRESVMRIPMEI 241 >SB_41319| Best HMM Match : NACHT (HMM E-Value=5.2e-14) Length = 961 Score = 27.9 bits (59), Expect = 6.6 Identities = 13/46 (28%), Positives = 26/46 (56%) Frame = +2 Query: 170 TDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKIKVN 307 T+++V + +EI I E ++ HE++ + +I TEK+ V+ Sbjct: 376 TNKVVHEVKGKVSEISIKTDETNKVVHEVKGKVSEISIKTEKMAVD 421 >SB_32475| Best HMM Match : IWS1_C (HMM E-Value=0) Length = 768 Score = 27.9 bits (59), Expect = 6.6 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +2 Query: 281 ENTEKIKVNKTLPYLVSNVIELLDVDPQEEEEDGA 385 E ++ + ++T P N +E V P+ EEEDGA Sbjct: 56 EGEKEDEASETSPRGSENSVESRSVSPKNEEEDGA 90 >SB_29265| Best HMM Match : OmpH (HMM E-Value=3) Length = 218 Score = 27.9 bits (59), Expect = 6.6 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 4/50 (8%) Frame = +2 Query: 344 LLDVDPQEEE--EDGAVVDLDSQ--RKGKCAVIKTSTRQTYFLPVIGLVD 481 L D D E E +D VD++++ KGK K+S + Y PV+ L D Sbjct: 25 LCDTDAPEAEVVDDEPEVDVETETEEKGKAETKKSSEPEEYTPPVVALED 74 >SB_4879| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 607 Score = 27.9 bits (59), Expect = 6.6 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = +2 Query: 50 NLKDYYEKTNHNITMATTLEDKSIWEDGEEALSEEVLR 163 N + YE N + M + L+D E GEE EEV R Sbjct: 391 NNNNNYESDNSDTNMISDLDDDDDDESGEEEEEEEVNR 428 >SB_38518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1399 Score = 27.5 bits (58), Expect = 8.7 Identities = 15/37 (40%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = +2 Query: 347 LDVDPQEEEEDGAVVDLDSQRKGKCAVIKTS-TRQTY 454 +D P+E + DGAVV++ S +G V ++S +RQ+Y Sbjct: 477 MDEVPEEMDSDGAVVNIQSAMRGH--VTRSSLSRQSY 511 >SB_37864| Best HMM Match : Extensin_2 (HMM E-Value=0.064) Length = 1230 Score = 27.5 bits (58), Expect = 8.7 Identities = 26/109 (23%), Positives = 51/109 (46%), Gaps = 1/109 (0%) Frame = +2 Query: 263 QNDKIKENTEKIKVNKTLPYLVSNVIELLDVDPQEEEEDGAVVDLDSQRKGKCAVIKTS- 439 Q+DK+ + K++ + +++++ + + +DP EE +L S K + + K Sbjct: 313 QDDKVAQAKAKLQHAEKASDVLTSMEKEMGLDPSTAEEK--TKNLTSVLKDEMSKFKDLI 370 Query: 440 TRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPAEYDARVKAME 586 +Q + EKL D+ G N LI+E A+Y A+ +A + Sbjct: 371 NKQDDSVKKEKFEKLEKLAEEDVKGTNDVMKLIVELEVAKYFAKQRARQ 419 >SB_27802| Best HMM Match : Filament (HMM E-Value=0.2) Length = 528 Score = 27.5 bits (58), Expect = 8.7 Identities = 12/51 (23%), Positives = 29/51 (56%) Frame = +2 Query: 149 EEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKIK 301 E+ + +EI+ + IK+ + + R+ HE+Q +ND + ++ +++K Sbjct: 114 EDEIAQEKEEILELKNKHSDSIKLAE-DTNRLLHEVQRKNDSLAKDMKRVK 163 >SB_45719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 429 Score = 27.5 bits (58), Expect = 8.7 Identities = 13/34 (38%), Positives = 24/34 (70%), Gaps = 3/34 (8%) Frame = +2 Query: 203 DNEIKIMKSEVMRISHELQ---AQNDKIKENTEK 295 D++I+++KSE+ + S E+Q AQ D++K +K Sbjct: 274 DDQIQMLKSELEKASTEMQGIAAQVDEVKSQADK 307 >SB_18003| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 531 Score = 27.5 bits (58), Expect = 8.7 Identities = 12/53 (22%), Positives = 26/53 (49%) Frame = +2 Query: 125 EDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKE 283 + E+ + R P D V ++++ E+K+ K+ + H ++ D+ KE Sbjct: 309 QKSEKEVDASSERAPKDNKVRKSKIKTEELKVPKALEREVGHAKTSKKDESKE 361 >SB_7056| Best HMM Match : Seryl_tRNA_N (HMM E-Value=8.1) Length = 94 Score = 27.5 bits (58), Expect = 8.7 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 4/38 (10%) Frame = +2 Query: 200 LDNEIK----IMKSEVMRISHELQAQNDKIKENTEKIK 301 LD E++ +M E R++ ELQAQ DK+ ++++ Sbjct: 22 LDKELEWRRDVMNKEYTRLASELQAQEDKVLNMKQQVQ 59 >SB_4536| Best HMM Match : Krr1 (HMM E-Value=4) Length = 246 Score = 27.5 bits (58), Expect = 8.7 Identities = 20/75 (26%), Positives = 39/75 (52%) Frame = +2 Query: 188 RTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKIKVNKTLPYLVSNVIELLDVDPQE 367 R R L+ ++ MK E +A+ K+ ++ K V+ +P+ N++ELL DP++ Sbjct: 93 RKRQLNILLEKMKGERSLRQQLNKARKSKMLKSRSKRLVDLGVPH---NLLELLPEDPED 149 Query: 368 EEEDGAVVDLDSQRK 412 + +V+L R+ Sbjct: 150 AMPEEIIVELGRIRE 164 >SB_3154| Best HMM Match : DUF812 (HMM E-Value=1.8) Length = 815 Score = 27.5 bits (58), Expect = 8.7 Identities = 24/86 (27%), Positives = 45/86 (52%), Gaps = 6/86 (6%) Frame = +2 Query: 107 EDKSIWEDGEEALSEEVLRMPTD------EIVSRTRLLDNEIKIMKSEVMRISHELQAQN 268 +DK I E+ + +EV + D E+V+R RL D E+ ++ + EL N Sbjct: 618 KDKYIQEELRQLSDKEVYKETKDLTQYITELVNR-RLSDKEVYKETKDLTQYITELV--N 674 Query: 269 DKIKENTEKIKVNKTLPYLVSNVIEL 346 ++++ + ++KTL YL+ NV ++ Sbjct: 675 RRVRKLSADGFIDKTLDYLIINVRDM 700 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,019,596 Number of Sequences: 59808 Number of extensions: 272939 Number of successful extensions: 954 Number of sequences better than 10.0: 39 Number of HSP's better than 10.0 without gapping: 877 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 949 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1439498375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -