BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11j08f (613 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 25 0.77 AB178034-1|BAD27112.1| 76|Apis mellifera apiceropsin protein. 25 0.77 L01588-1|AAA27735.1| 74|Apis mellifera zinc finger protein pro... 22 5.4 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 21 7.2 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 21 7.2 AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 21 7.2 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 21 9.5 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 21 9.5 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 24.6 bits (51), Expect = 0.77 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -3 Query: 335 RGSENFLPRSRLKPNTVFFILVTIWFLAATP 243 R SEN + K V + +++WF+A TP Sbjct: 263 RSSENQNTSAECKLAKVALMTISLWFMAWTP 293 >AB178034-1|BAD27112.1| 76|Apis mellifera apiceropsin protein. Length = 76 Score = 24.6 bits (51), Expect = 0.77 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -3 Query: 335 RGSENFLPRSRLKPNTVFFILVTIWFLAATP 243 R SEN + K V + +++WF+A TP Sbjct: 13 RSSENQNTSAECKLAKVALMTISLWFMAWTP 43 >L01588-1|AAA27735.1| 74|Apis mellifera zinc finger protein protein. Length = 74 Score = 21.8 bits (44), Expect = 5.4 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -2 Query: 102 HSSHCDRQ 79 H SHCDRQ Sbjct: 39 HCSHCDRQ 46 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.4 bits (43), Expect = 7.2 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = -2 Query: 408 DSYSNTAIRPLFNLEREMF*FFLNKRV 328 D + NTA+ FN+ +M+ + L+ V Sbjct: 120 DVFYNTAVWARFNVNEQMYLYALSVAV 146 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.4 bits (43), Expect = 7.2 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = -2 Query: 408 DSYSNTAIRPLFNLEREMF*FFLNKRV 328 D + NTA+ FN+ +M+ + L+ V Sbjct: 120 DVFYNTAVWARFNVNEQMYLYALSVAV 146 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 21.4 bits (43), Expect = 7.2 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +3 Query: 321 IFRPSCSKRIKTFPF 365 IFR SC ++ FPF Sbjct: 126 IFRSSCDIDVEFFPF 140 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.0 bits (42), Expect = 9.5 Identities = 6/17 (35%), Positives = 9/17 (52%) Frame = -3 Query: 278 ILVTIWFLAATPNIRFF 228 +L +W + P RFF Sbjct: 640 VLTLVWMIIEPPGTRFF 656 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.0 bits (42), Expect = 9.5 Identities = 6/17 (35%), Positives = 9/17 (52%) Frame = -3 Query: 278 ILVTIWFLAATPNIRFF 228 +L +W + P RFF Sbjct: 730 VLTLVWMIIEPPGTRFF 746 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,022 Number of Sequences: 438 Number of extensions: 3737 Number of successful extensions: 11 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18093444 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -