BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11j06r (769 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g05030.1 68415.m00525 hypothetical protein 32 0.37 At5g01840.1 68418.m00103 ovate family protein 59% similar to ova... 30 2.0 At2g36250.2 68415.m04450 chloroplast division protein FtsZ (FtsZ... 29 2.6 At2g36250.1 68415.m04449 chloroplast division protein FtsZ (FtsZ... 29 2.6 At5g47140.1 68418.m05811 zinc finger (GATA type) family protein ... 29 4.5 At5g03360.1 68418.m00289 DC1 domain-containing protein contains ... 29 4.5 At4g17570.1 68417.m02627 zinc finger (GATA type) family protein 29 4.5 At2g48020.2 68415.m06011 sugar transporter, putative similar to ... 28 6.0 At2g48020.1 68415.m06010 sugar transporter, putative similar to ... 28 6.0 At3g56170.1 68416.m06243 Ca(2+)-dependent nuclease identical to ... 28 7.9 At3g18080.1 68416.m02299 glycosyl hydrolase family 1 protein con... 28 7.9 At2g17240.1 68415.m01991 expressed protein 28 7.9 At1g31290.1 68414.m03829 PAZ domain-containing protein / piwi do... 28 7.9 >At2g05030.1 68415.m00525 hypothetical protein Length = 205 Score = 32.3 bits (70), Expect = 0.37 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +1 Query: 73 SDGQRSTVPKSRHQRGRGCGGEDHRSHPGTGRDHRRPKHQS 195 S G+RS +P+S G +DHR G +DHRR + Q+ Sbjct: 65 SSGERS-LPRSSTSTDDRVGYQDHRRDQGQDQDHRRDQQQN 104 >At5g01840.1 68418.m00103 ovate family protein 59% similar to ovate protein (GI:23429649) [Lycopersicon esculentum]; contains TIGRFAM TIGR01568 : uncharacterized plant-specific domain TIGR01568 Length = 270 Score = 29.9 bits (64), Expect = 2.0 Identities = 18/60 (30%), Positives = 25/60 (41%) Frame = +3 Query: 12 FYELDWIQEVKRETRTLTPGKRRSAQYCPQEQTPTRTRLWRRGPPESPWHWSRPPTSKTP 191 FY+L + + K++ P S + TPT T PP P H S+ P S P Sbjct: 18 FYKLRDMSKSKKKNLQSQPNSTTSKKKHHAVPTPTSTTPLSPRPPRRPSHSSKAPPSHPP 77 >At2g36250.2 68415.m04450 chloroplast division protein FtsZ (FtsZ2-1) identical to chloroplast division protein AtFtsZ2-1 [Arabidopsis thaliana] GI:15636809, plastid division protein FtsZ [Arabidopsis thaliana] GI:14195704 Length = 478 Score = 29.5 bits (63), Expect = 2.6 Identities = 19/75 (25%), Positives = 32/75 (42%), Gaps = 3/75 (4%) Frame = -1 Query: 376 AGANYNLGDNQVVWAAGWGATSLGGSNSEQLRHVQVWTINQNACVQRYRPI---NRAITA 206 A +NYN +V+ G G+ ++ ++ V+ W +N + R P+ NR Sbjct: 112 APSNYNEARIKVIGVGGGGSNAVNRMIESEMSGVEFWIVNTDIQAMRMSPVLPDNRLQIG 171 Query: 205 NMLCSGVLDVGGRDQ 161 L G L GG + Sbjct: 172 KELTRG-LGAGGNPE 185 >At2g36250.1 68415.m04449 chloroplast division protein FtsZ (FtsZ2-1) identical to chloroplast division protein AtFtsZ2-1 [Arabidopsis thaliana] GI:15636809, plastid division protein FtsZ [Arabidopsis thaliana] GI:14195704 Length = 478 Score = 29.5 bits (63), Expect = 2.6 Identities = 19/75 (25%), Positives = 32/75 (42%), Gaps = 3/75 (4%) Frame = -1 Query: 376 AGANYNLGDNQVVWAAGWGATSLGGSNSEQLRHVQVWTINQNACVQRYRPI---NRAITA 206 A +NYN +V+ G G+ ++ ++ V+ W +N + R P+ NR Sbjct: 112 APSNYNEARIKVIGVGGGGSNAVNRMIESEMSGVEFWIVNTDIQAMRMSPVLPDNRLQIG 171 Query: 205 NMLCSGVLDVGGRDQ 161 L G L GG + Sbjct: 172 KELTRG-LGAGGNPE 185 >At5g47140.1 68418.m05811 zinc finger (GATA type) family protein contains Pfam:PF00320 GATA zinc finger domain Length = 470 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +3 Query: 69 GKRRSAQYCPQEQTPTRTRLWRRGPPESP 155 GK+ +C TP LWR GPPE P Sbjct: 2 GKQGPCYHCGVTSTP----LWRNGPPEKP 26 >At5g03360.1 68418.m00289 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 1610 Score = 28.7 bits (61), Expect = 4.5 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +1 Query: 109 HQRGRGCGGEDHRSHPGTGRDHRRPKH 189 H R RGC GE+H+ + D + P H Sbjct: 1223 HFRCRGCNGENHKGYEQAPVDVKHPLH 1249 >At4g17570.1 68417.m02627 zinc finger (GATA type) family protein Length = 510 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +3 Query: 69 GKRRSAQYCPQEQTPTRTRLWRRGPPESP 155 GK+ +C TP LWR GPPE P Sbjct: 2 GKQGPCYHCGVTNTP----LWRNGPPEKP 26 >At2g48020.2 68415.m06011 sugar transporter, putative similar to ERD6 protein {Arabidopsis thaliana} GI:3123712, sugar-porter family proteins 1 and 2 [Arabidopsis thaliana] GI:14585699, GI:14585701; contains Pfam profile PF00083: major facilitator superfamily protein Length = 463 Score = 28.3 bits (60), Expect = 6.0 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = -1 Query: 730 PTNPQRIIGGSTTNINQYPGIAALLYTWNWNQWWQSCG 617 P N + + GG T +N + G A+ YT+N+ W S G Sbjct: 390 PINIKGVAGGMATLVNWF-GAWAVSYTFNFLMSWSSYG 426 >At2g48020.1 68415.m06010 sugar transporter, putative similar to ERD6 protein {Arabidopsis thaliana} GI:3123712, sugar-porter family proteins 1 and 2 [Arabidopsis thaliana] GI:14585699, GI:14585701; contains Pfam profile PF00083: major facilitator superfamily protein Length = 463 Score = 28.3 bits (60), Expect = 6.0 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = -1 Query: 730 PTNPQRIIGGSTTNINQYPGIAALLYTWNWNQWWQSCG 617 P N + + GG T +N + G A+ YT+N+ W S G Sbjct: 390 PINIKGVAGGMATLVNWF-GAWAVSYTFNFLMSWSSYG 426 >At3g56170.1 68416.m06243 Ca(2+)-dependent nuclease identical to Ca(2+)-dependent nuclease [Arabidopsis thaliana] GI:7684292; supporting cDNA gi|7684291|dbj|D84226.1| Length = 323 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/33 (33%), Positives = 12/33 (36%) Frame = +3 Query: 72 KRRSAQYCPQEQTPTRTRLWRRGPPESPWHWSR 170 KR E R LW PE PW W + Sbjct: 285 KRAELAKWENEARQKRVGLWASSNPEKPWEWRK 317 >At3g18080.1 68416.m02299 glycosyl hydrolase family 1 protein contains Pfam PF00232 : Glycosyl hydrolase family 1 domain; TIGRFAM TIGR01233: 6-phospho-beta-galactosidase; similar to beta-glucosidase BGQ60 precursor GB:A57512 [Hordeum vulgare]; similar to beta-mannosidase enzyme (GI:17226270) [Lycopersicon esculentum] Length = 512 Score = 27.9 bits (59), Expect = 7.9 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 319 HPNQQPKQLGYHQDCN 366 HP +PK LGY QD N Sbjct: 356 HPTTKPKDLGYQQDWN 371 >At2g17240.1 68415.m01991 expressed protein Length = 140 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/41 (29%), Positives = 17/41 (41%) Frame = +3 Query: 72 KRRSAQYCPQEQTPTRTRLWRRGPPESPWHWSRPPTSKTPE 194 +R Q P +L RR P + P W RP + P+ Sbjct: 50 RRNRNQLQVVSMAPEEEKLTRRNPLDFPIEWERPKPGRRPD 90 >At1g31290.1 68414.m03829 PAZ domain-containing protein / piwi domain-containing protein contains Pfam profiles PF02170: PAZ domain, PF02171: Piwi domain Length = 1194 Score = 27.9 bits (59), Expect = 7.9 Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Frame = +1 Query: 28 GSKR*NGKRER*HQGSDGQRSTVPKSRHQ-RGRGCGGEDHRSHPGTGRDHRR 180 G + +G+ + +G G R R RGRG GG+ R + G G H R Sbjct: 39 GDRGYSGRGDGHGRGGGGDRGRGYSGRGDGRGRGGGGDRGRGYSGRGDGHGR 90 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,251,423 Number of Sequences: 28952 Number of extensions: 426239 Number of successful extensions: 1357 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 1276 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1356 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1721869952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -